LXL04_013542 | RubberDandelionOmics

Gene overview

LXL04_013542

Reference: OH-1004 Chr: Chr03 Coordinates: 31247671-31254309 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

4542 bp · LXL04_013542|LXL04_013542|OH1004|cDNA

ATGGAAGATGACAACCAGAGACAAAGGAGGAAAAGAGGAACGGGGTCAGAGAAGCGTGCTGAACTACTCCGCAAGCTCAAAACCCGCAGAGAAGGCGGCGGCGGCGGCGAAATTGGCGGAGAACGTTACCAGATAAAGATCGATGAACCAATCTACGATACTGTCGACGACGATGAGTACGAGAGCCTCGTGGCGCAACGGCGTAAAGAATTCGAAGGGTTTATCGTCGACGACGATGGCCTTGGTTACGGGGACGAAGG...

CDS

Download CDS FASTA

4542 bp · LXL04_013542|LXL04_013542|OH1004|CDS

ATGGAAGATGACAACCAGAGACAAAGGAGGAAAAGAGGAACGGGGTCAGAGAAGCGTGCTGAACTACTCCGCAAGCTCAAAACCCGCAGAGAAGGCGGCGGCGGCGGCGAAATTGGCGGAGAACGTTACCAGATAAAGATCGATGAACCAATCTACGATACTGTCGACGACGATGAGTACGAGAGCCTCGTGGCGCAACGGCGTAAAGAATTCGAAGGGTTTATCGTCGACGACGATGGCCTTGGTTACGGGGACGAAGG...

Protein

Download Protein FASTA

1513 aa · LXL04_013542|LXL04_013542|OH1004|PROTEIN

MEDDNQRQRRKRGTGSEKRAELLRKLKTRREGGGGGEIGGERYQIKIDEPIYDTVDDDEYESLVAQRRKEFEGFIVDDDGLGYGDEGEEVDWTKSGVVPSSEEESEGELGKRKPKKAKTEKKEKKEQKKPSFEAAAALMGKQRISNLFTSAVFNKCKPSVVSNDSLIDDVLAEFAPDENDKEKRRRGNKKPSQNGTVSVQTSLITPVKAEITPVKAEITPVSSVIVNTPSSNSLNKHDLLEQEKEVLEIPKNETDLGVVE...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_013542`
TK1151 ID	TkA02G490860
OH-1004 ID	LXL04_013542
Relationship / confidence	Sequence Supported Annotation Or Model Conflict / Review
Protein identity (%)	98.700
Protein coverage (%)	TK1151 98.841 / OH-1004 45.076 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_013542

Location Chr03:31247671-31254309 (+)

Description Similar to Os01g0868300: DNA polymerase alpha catalytic subunit

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At5g67100`	Polymerase alpha in a complex with DNA primase is a replicative polymerase.	No verified direct reference in this release

Rice

Reference gene ID	Possible function	Papers / DOI
`Os01g0868300`	Polymerase alpha in a complex with DNA primase is a replicative polymerase.	No verified direct reference in this release

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_013542 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0000731 DNA synthesis involved in DNA repair Biological Process

GO:0006260 DNA replication Biological Process

GO:0006269 DNA replication, synthesis of primer Biological Process

GO:0006270 DNA replication initiation Biological Process

GO:0006271 DNA strand elongation involved in DNA replication Biological Process

GO:0006272 leading strand elongation Biological Process

GO:0006273 lagging strand elongation Biological Process

GO:0006281 DNA repair Biological Process

GO:0006303 double-strand break repair via nonhomologous end joining Biological Process

GO:0009965 leaf morphogenesis Biological Process

GO:0032479 regulation of type I interferon production Biological Process

GO:0071897 DNA biosynthetic process Biological Process

KEGG gene cross-reference

ath:AT5G67100

hsa:5422

rno:85241

xla:398200

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.788

Rank 1 · LXL04_013542 · OH-1004

Cytoplasm0.217

Rank 2 · LXL04_013542 · OH-1004

Mitochondrion0.067

Rank 3 · LXL04_013542 · OH-1004

Cell membrane0.034

Rank 4 · LXL04_013542 · OH-1004

Endoplasmic reticulum0.021

Rank 5 · LXL04_013542 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF12254.14DNA_pol_alpha_N23-89 aa

PF03104.26DNA_pol_B_exo1490-746 aa

PF00136.27DNA_pol_B811-1270 aa

PF08996.16zf-DNA_Pol1310-1510 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_013542	`PF12254.14`	DNA_pol_alpha_N	23	89	4.7e-16	59.4
LXL04_013542	`PF03104.26`	DNA_pol_B_exo1	490	746	4.6e-30	105.5
LXL04_013542	`PF00136.27`	DNA_pol_B	811	1270	2e-125	419.9
LXL04_013542	`PF08996.16`	zf-DNA_Pol	1310	1510	6.4e-43	147.4

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9FHA3`	Arabidopsis thaliana	DNA polymerase alpha catalytic subunit	57.980%	Swiss-Prot	strong database homology
`O48653`	Oryza sativa subsp. japonica	DNA polymerase alpha catalytic subunit	61.443%	Swiss-Prot	strong database homology

JBrowse

View in Genome Browser

Gene Card