LXL04_013538 | RubberDandelionOmics

Gene overview

LXL04_013538

Reference: OH-1004 Chr: Chr03 Coordinates: 31160145-31162604 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1176 bp · LXL04_013538|LXL04_013538|OH1004|cDNA

ATGATCATGGATACACCGATGGAGTGGGTGAGAGGTCAAGCAATAGGCCATGGAAGCTTCGCAGTTGTCAATTTGGCAAAACCAACAAGCCAGAGTTCACGTTTACCGCCATTGATGGCCGTCAAAACTTGTGGGGCATCTCAGTCTGATTCGTTAAAGAAAGAGTGTGTGATCTTGAATGAACTTAAGGATTGCCCGGAGATCATCACGTGTTACGGCGACAATATCACCACTGAAAACGGCGAGAGACTGTATAACGT...

CDS

Download CDS FASTA

1176 bp · LXL04_013538|LXL04_013538|OH1004|CDS

ATGATCATGGATACACCGATGGAGTGGGTGAGAGGTCAAGCAATAGGCCATGGAAGCTTCGCAGTTGTCAATTTGGCAAAACCAACAAGCCAGAGTTCACGTTTACCGCCATTGATGGCCGTCAAAACTTGTGGGGCATCTCAGTCTGATTCGTTAAAGAAAGAGTGTGTGATCTTGAATGAACTTAAGGATTGCCCGGAGATCATCACGTGTTACGGCGACAATATCACCACTGAAAACGGCGAGAGACTGTATAACGT...

Protein

Download Protein FASTA

391 aa · LXL04_013538|LXL04_013538|OH1004|PROTEIN

MIMDTPMEWVRGQAIGHGSFAVVNLAKPTSQSSRLPPLMAVKTCGASQSDSLKKECVILNELKDCPEIITCYGDNITTENGERLYNVALEYASGGSLAERVKSSDNFGLPESDVRRYTNSVLKGLLFTHRSGFVHCDIKLQNILLFSGDGNGKDHVKIADFGLAKKAAEESNSKSKNEIRGTPMYMAPETVIAGEQGPASDIWAVGCLVLELLTGKPAWSCSDVAAVLMKIGVGAEIPDIPGKLSDAGKDFLGKCFVKDH...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_013538`
TK1151 ID	TkA02G491290
OH-1004 ID	LXL04_013538
Relationship / confidence	Multi Source To Oh1004 / Complex relationship
Protein identity (%)	74.400
Protein coverage (%)	TK1151 100.000 / OH-1004 63.939 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_013538

Location Chr03:31160145-31162604 (+)

Description Similar to MAPKKK20: Mitogen-activated protein kinase kinase kinase 20

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At3g50310`	Mitogen-activated protein kinase kinase (MAPKK) that phosphorylates both MKK3 and MPK18 and regulate two separate signaling pathways involved in root microtubule functions.	Arabidopsis MKKK20 is involved in osmotic stress response via regulation of MPK6 activity.2012 · DOI: 10.1007/s00299-011-1157-0 AIK1, A Mitogen-Activated Protein Kinase, Modulates Abscisic Acid Responses through the MKK5-MPK6 Kinase Cascade.2017 · DOI: 10.1104/pp.16.01386 The Arabidopsis Mitogen-Activated Protein Kinase Kinase Kinase 20 (MKKK20) Acts Upstream of MKK3 and MPK18 in Two Separate Signaling Pathways Involved in Root Microtubule Functions.2017 · DOI: 10.3389/fpls.2017.01352
`At2g32510`	Component of the abscisic acid (ABA) signaling pathway that may act as ABA signal transducer in the context of abiotic stresses.	No verified direct reference in this release
`At1g05100`	Component of the abscisic acid (ABA) signaling pathway that acts as ABA signal transducer in the context of abiotic stresses.	An abscisic acid inducible Arabidopsis MAPKKK, MAPKKK18 regulates leaf senescence via its kinase activity.2015 · DOI: 10.1007/s11103-015-0295-0 Arabidopsis ABA-Activated Kinase MAPKKK18 is Regulated by Protein Phosphatase 2C ABI1 and the Ubiquitin-Proteasome Pathway.2015 · DOI: 10.1093/pcp/pcv146
`At1g63700`	Functions in a MAP kinase cascade that acts as a molecular switch to regulate the first cell fate decisions in the zygote and the early embryo.	No verified direct reference in this release
`At1g54960`	Involved in cortical microtubules organization and stabilization by regulating the phosphorylation state of microtubule- associated proteins such as MAP65-1.	Arabidopsis homologs of nucleus- and phragmoplast-localized kinase 2 and 3 and mitogen-activated protein kinase 4 are essential for microtubule organization.2010 · DOI: 10.1105/tpc.109.071746

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_013538 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0000165 MAPK cascade Biological Process

GO:0000302 response to reactive oxygen species Biological Process

GO:0006468 protein phosphorylation Biological Process

GO:0006970 response to osmotic stress Biological Process

GO:0007165 signal transduction Biological Process

GO:0009409 response to cold Biological Process

GO:0009414 response to water deprivation Biological Process

GO:0009651 response to salt stress Biological Process

GO:0009737 response to abscisic acid Biological Process

GO:0009738 abscisic acid-activated signaling pathway Biological Process

GO:0009789 positive regulation of abscisic acid-activated signaling pathway Biological Process

GO:0010029 regulation of seed germination Biological Process

KEGG gene cross-reference

ath:AT1G05100

ath:AT1G54960

ath:AT1G63700

ath:AT2G32510

ath:AT3G50310

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.696

Rank 1 · LXL04_013538 · OH-1004

Cytoplasm0.364

Rank 2 · LXL04_013538 · OH-1004

Cell membrane0.083

Rank 3 · LXL04_013538 · OH-1004

Endoplasmic reticulum0.045

Rank 4 · LXL04_013538 · OH-1004

Plastid0.026

Rank 5 · LXL04_013538 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00069.32Pkinase11-275 aa

PF07714.24PK_Tyr_Ser-Thr12-270 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_013538	`PF00069.32`	Pkinase	11	275	2.2e-51	175.5
LXL04_013538	`PF07714.24`	PK_Tyr_Ser-Thr	12	270	3.7e-30	105.8

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9SND6`	Arabidopsis thaliana	Mitogen-activated protein kinase kinase kinase 20	48.747%	Swiss-Prot	moderate database homology
`O80888`	Arabidopsis thaliana	Mitogen-activated protein kinase kinase kinase 17	38.182%	Swiss-Prot	moderate database homology
`Q9ZVP5`	Arabidopsis thaliana	Mitogen-activated protein kinase kinase kinase 18	40.071%	Swiss-Prot	moderate database homology
`Q9CAD5`	Arabidopsis thaliana	Mitogen-activated protein kinase kinase kinase YODA	37.818%	Swiss-Prot	moderate database homology
`Q9FZ36`	Arabidopsis thaliana	Mitogen-activated protein kinase kinase kinase 2	35.032%	Swiss-Prot	moderate database homology

JBrowse

View in Genome Browser

Gene Card