LXL04_013490 | RubberDandelionOmics

Gene overview

LXL04_013490

Reference: OH-1004 Chr: Chr03 Coordinates: 30403941-30405413 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1473 bp · LXL04_013490|LXL04_013490|OH1004|cDNA

ATGATCAGAAACTCACCGCCAGGAAATATCCCGGCGAATTCATACAACGATGGGAATGTACAACCGCAGAAGCCGTCGGGAAAGTTTACAAGCAACAATGATCATCATCATCCCAAAGATATTGGAGATCAGCTGTCTTTTCGCCTGAACAAAATTCCAGACGCCAGTCGTCCTCCGCCGCTGCCGCTGGAGGATATCGATTCTCCGACGGAGGATGACGCATCTCAACGAGATTCATATACATCGCGTCTGTTCTATGG...

CDS

Download CDS FASTA

1473 bp · LXL04_013490|LXL04_013490|OH1004|CDS

ATGATCAGAAACTCACCGCCAGGAAATATCCCGGCGAATTCATACAACGATGGGAATGTACAACCGCAGAAGCCGTCGGGAAAGTTTACAAGCAACAATGATCATCATCATCCCAAAGATATTGGAGATCAGCTGTCTTTTCGCCTGAACAAAATTCCAGACGCCAGTCGTCCTCCGCCGCTGCCGCTGGAGGATATCGATTCTCCGACGGAGGATGACGCATCTCAACGAGATTCATATACATCGCGTCTGTTCTATGG...

Protein

Download Protein FASTA

490 aa · LXL04_013490|LXL04_013490|OH1004|PROTEIN

MIRNSPPGNIPANSYNDGNVQPQKPSGKFTSNNDHHHPKDIGDQLSFRLNKIPDASRPPPLPLEDIDSPTEDDASQRDSYTSRLFYGPSTSQQMSPLTRSPWSSYVEKSVPDSSDPFSNYTGLLASLVREEGNIYSLVASGDLLYTGSDSKNIRVWKSQKEFSWFKSNSGLVKSIVIAGEKIFTGHQDGKIRVWKVSPKNPSVHKRIGTLPSFKSVVKKSMKPKNYIEVRGTQRIWIKHFDAISSLSFSEDQSLLYSGSW...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_013490`
TK1151 ID	TkA02G493900
OH-1004 ID	LXL04_013490
Relationship / confidence	Non Reciprocal Best Hit / Complex relationship
Protein identity (%)	56.500
Protein coverage (%)	TK1151 98.658 / OH-1004 46.939 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_013490

Location Chr03:30403941-30405413 (-)

Description Similar to JGB: Protein JINGUBANG

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At2g26490`	Negative regulator of pollen germination.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_013490 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0009846 pollen germination Biological Process

GO:0005634 nucleus Cellular Component

GO:0005737 cytoplasm Cellular Component

KEGG gene cross-reference

ana:alr3466

ath:AT2G26490

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.408

Rank 1 · LXL04_013490 · OH-1004

Cytoplasm0.398

Rank 2 · LXL04_013490 · OH-1004

Cell membrane0.210

Rank 3 · LXL04_013490 · OH-1004

Lysosome / Vacuole0.067

Rank 4 · LXL04_013490 · OH-1004

Endoplasmic reticulum0.052

Rank 5 · LXL04_013490 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF24017.3Beta-prop_SCAP119-359 aa

PF25171.2Beta-prop_WDR36-Utp21_1st130-227 aa

PF24817.2WD40_WDHD1_1st134-220 aa

PF23414.2Beta-prop_EML_2142-287 aa

PF24105.2Beta-prop_CAF1B_HIR1181-308 aa

PF25391.2WD40_Gbeta232-397 aa

PF24817.2WD40_WDHD1_1st234-311 aa

PF00400.39WD40237-267 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_013490	`PF24017.3`	Beta-prop_SCAP	119	359	2.3e-18	67.0
LXL04_013490	`PF25171.2`	Beta-prop_WDR36-Utp21_1st	130	227	1.9e-11	44.6
LXL04_013490	`PF24817.2`	WD40_WDHD1_1st	134	220	2.2e-26	93.4
LXL04_013490	`PF23414.2`	Beta-prop_EML_2	142	287	4.7e-16	59.7
LXL04_013490	`PF24105.2`	Beta-prop_CAF1B_HIR1	181	308	4.1e-10	39.9
LXL04_013490	`PF25391.2`	WD40_Gbeta	232	397	1.8e-18	67.4
LXL04_013490	`PF24817.2`	WD40_WDHD1_1st	234	311	2.2e-26	93.4
LXL04_013490	`PF00400.39`	WD40	237	267	4.6e-38	128.7
LXL04_013490	`PF25173.2`	Beta-prop_WDR3_1st	238	357	4.6e-34	118.4
LXL04_013490	`PF24796.2`	WDR55	238	428	2e-17	63.9
LXL04_013490	`PF20426.5`	NBCH_WD40	238	274	1.1e-12	48.2
LXL04_013490	`PF25175.2`	Beta-prop_WDR5	239	357	2.6e-31	109.7
LXL04_013490	`PF25047.1`	Beta-prop_TEP1_2nd	239	311	9e-21	74.9
LXL04_013490	`PF24805.2`	EIF3I	239	319	6.9e-15	55.7
LXL04_013490	`PF25174.2`	Beta-prop_THOC3	240	317	1.7e-25	90.3
LXL04_013490	`PF24807.2`	WD40_CDC20-Fz	240	378	3.9e-21	76.3

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`O48716`	Arabidopsis thaliana	Protein JINGUBANG	62.670%	Swiss-Prot	strong database homology

JBrowse

View in Genome Browser

Gene Card