Gene Card
Gene overview
cDNA / CDS / Protein Sequences
1506 bp · LXL04_013410|LXL04_013410|OH1004|cDNA
ATGGAAACGAAAGGGAATACGGCCGGAGCAGTCTCGCTGACACCATCCAAATCAAAGCTTCCACACAAGTCTAAATTGCCGGAGAATTCCAACCCTAACGTAACTAGTCCTGACACCAAGGCATCAAAATCTCCAGCAATCAAATCGGCGACTAAAGCTCAGAAGAAACCGAATCAGGTTGCGTCACCTTCTCCTAGGAATAAGATTCGAGAGAGGAAGTTTGTGGTGGCGAAGAAGAATTCAAAGAAGGAGAAATCTAA...
1506 bp · LXL04_013410|LXL04_013410|OH1004|CDS
ATGGAAACGAAAGGGAATACGGCCGGAGCAGTCTCGCTGACACCATCCAAATCAAAGCTTCCACACAAGTCTAAATTGCCGGAGAATTCCAACCCTAACGTAACTAGTCCTGACACCAAGGCATCAAAATCTCCAGCAATCAAATCGGCGACTAAAGCTCAGAAGAAACCGAATCAGGTTGCGTCACCTTCTCCTAGGAATAAGATTCGAGAGAGGAAGTTTGTGGTGGCGAAGAAGAATTCAAAGAAGGAGAAATCTAA...
Protein
Download Protein FASTA501 aa · LXL04_013410|LXL04_013410|OH1004|PROTEIN
METKGNTAGAVSLTPSKSKLPHKSKLPENSNPNVTSPDTKASKSPAIKSATKAQKKPNQVASPSPRNKIRERKFVVAKKNSKKEKSKTPASVNCKCKASSNSKKCLCIAYETLRASQEGFFNFGSANPSLPSEEAENEQTENPKLNGFEEKSGESETVDASGITVSEKVKRRRDKFLQVARQSIPEGGCGRVMHLVKAFETALTLPKSNTDGEELERNEEGEGDTRKVPKWELPGLRPKAPVTEFSSPDLFLTPENLGLD...
Flanking Sequence Download
Sequence orientation and download details
Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.
ID Mapping
| Input ID | LXL04_013410 |
|---|---|
| TK1151 ID | TkA02G497900 |
| OH-1004 ID | LXL04_013410 |
| Relationship / confidence | Rbh Below Probable Coverage Or Synteny Threshold / Review |
| Protein identity (%) | 82.800 |
| Protein coverage (%) | TK1151 100.000 / OH-1004 61.677Coverage and evidenceCoverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation. |
| Source version | OH-1004 / GCA_047496595.1_OSU_TarKok_2.0 |
SNP / Indel variants and carrier samplesCRA009020 · OH-1004
Expand to load variant records for this gene.
Basic Information and Functional Annotation
| Gene ID | LXL04_013410 | |||||||||
|---|---|---|---|---|---|---|---|---|---|---|
| Location | Chr03:29188965-29190863 (+) | |||||||||
| Description | Similar to TPX2: Protein TPX2 | |||||||||
| Arabidopsis / Rice Reference Genes and Papers |
Download references for this gene Arabidopsis
RiceNo hit for this species in the current source table. | |||||||||
| Functional annotation source | View annotation sourcesFunctional annotation source: OH1004 · | |||||||||
| GO annotations (OH1004 source) | GO:0000278 mitotic cell cycle Biological Process GO:0007019 microtubule depolymerization Biological Process GO:0009416 response to light stimulus Biological Process GO:0009723 response to ethylene Biological Process GO:0009826 unidimensional cell growth Biological Process GO:0043622 cortical microtubule organization Biological Process GO:0051225 spindle assembly Biological Process GO:0051301 cell division Biological Process GO:0060236 regulation of mitotic spindle organization Biological Process GO:0090307 mitotic spindle assembly Biological Process GO:1905421 regulation of plant organ morphogenesis Biological Process GO:1990785 response to water-immersion restraint stress Biological Process | |||||||||
| KEGG gene cross-reference | ath:AT1G03780 ath:AT3G01015 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene. |
Gene expression
View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.
Data sources and gene correspondence
Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.
Subcellular Localization Top 5
Computational predictions or homology annotations below do not replace localization experiments.
LocPro · Direct prediction · Computational prediction, not experimental localization
Predicted Functional Domains
Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.
PF06886.17TPX2409-483 aa| Gene ID | Domain ID | Domain Name | Start aa | End aa | E-value | Score |
|---|---|---|---|---|---|---|
| LXL04_013410 | PF06886.17 | TPX2 | 409 | 483 | 1.2e-22 | 80.4 |
Arabidopsis / Rice Protein Homology
Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.