LXL04_013403 | RubberDandelionOmics

Gene overview

LXL04_013403

Reference: OH-1004 Chr: Chr03 Coordinates: 29040448-29041585 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

417 bp · LXL04_013403|LXL04_013403|OH1004|cDNA

ATGTCAGGAGTTCAAGATTCACTAGAGATTAAATTCCGTTTGATTGATGGATCAGATATTGGTCCAAAGAGCTTTCCAGCAGCCGCAAGTGTCGCAACCTTGAAAGAAAGCATCCTTTCTCAATGGCCAAAAGAGAAGGAGAATGCACCAAGAACAGTAAaagatgtaaaaataattagtGCTGGAAAAATATTGGAGAATAATAAAACAGTAGGAGAATGCAGAAGTGCTTTATGCGATGTCCCTGGTGGAATTACAAC...

CDS

Download CDS FASTA

417 bp · LXL04_013403|LXL04_013403|OH1004|CDS

ATGTCAGGAGTTCAAGATTCACTAGAGATTAAATTCCGTTTGATTGATGGATCAGATATTGGTCCAAAGAGCTTTCCAGCAGCCGCAAGTGTCGCAACCTTGAAAGAAAGCATCCTTTCTCAATGGCCAAAAGAGAAGGAGAATGCACCAAGAACAGTAAAAGATGTAAAAATAATTAGTGCTGGAAAAATATTGGAGAATAATAAAACAGTAGGAGAATGCAGAAGTGCTTTATGCGATGTCCCTGGTGGAATTACAAC...

Protein

Download Protein FASTA

138 aa · LXL04_013403|LXL04_013403|OH1004|PROTEIN

MSGVQDSLEIKFRLIDGSDIGPKSFPAAASVATLKESILSQWPKEKENAPRTVKDVKIISAGKILENNKTVGECRSALCDVPGGITTMHVVISLPPQEKEKKATSNLKQNKCACIKIGGIVTNDDTPVEIRMGGQRRS

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_013403`
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_013403

Location Chr03:29040448-29041585 (-)

Description Similar to MUB1: Membrane-anchored ubiquitin-fold protein 1

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At3g01050`	May serve as docking site to facilitate the association of other proteins to the plasma membrane.	No verified direct reference in this release
`At5g15460`	May serve as docking site to facilitate the association of other proteins to the plasma membrane.	No verified direct reference in this release
`At1g22050`	May serve as docking site to facilitate the association of other proteins to the plasma membrane.	No verified direct reference in this release

Rice

Reference gene ID	Possible function	Papers / DOI
`Os03g0426800`	May serve as docking site to facilitate the association of other proteins to the plasma membrane.	No verified direct reference in this release
`Os02g0750600`	May serve as docking site to facilitate the association of other proteins to the plasma membrane.	No verified direct reference in this release

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_013403 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0005886 plasma membrane Cellular Component

KEGG gene cross-reference

ath:AT1G22050

ath:AT3G01050

ath:AT5G15460

dosa:Os02g0750600

dosa:Os03g0426800

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.478

Rank 1 · LXL04_013403 · OH-1004

Nucleus0.322

Rank 2 · LXL04_013403 · OH-1004

Cell membrane0.219

Rank 3 · LXL04_013403 · OH-1004

Endoplasmic reticulum0.113

Rank 4 · LXL04_013403 · OH-1004

Golgi apparatus0.074

Rank 5 · LXL04_013403 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF13881.13Rad60-SLD_26-114 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_013403	`PF13881.13`	Rad60-SLD_2	6	114	7.2e-42	142.7

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9MAB9`	Arabidopsis thaliana	Membrane-anchored ubiquitin-fold protein 1	59.649%	Swiss-Prot	strong database homology
`Q8LCS8`	Arabidopsis thaliana	Membrane-anchored ubiquitin-fold protein 2	60.656%	Swiss-Prot	strong database homology
`Q8GWJ6`	Arabidopsis thaliana	Membrane-anchored ubiquitin-fold protein 6	50.000%	Swiss-Prot	strong database homology
`Q75GT2`	Oryza sativa subsp. japonica	Membrane-anchored ubiquitin-fold protein 1	59.649%	Swiss-Prot	strong database homology
`Q6Z8K4`	Oryza sativa subsp. japonica	Membrane-anchored ubiquitin-fold protein 3	49.138%	Swiss-Prot	moderate database homology

JBrowse

View in Genome Browser

Gene Card