Gene Card
Gene overview
cDNA / CDS / Protein Sequences
2451 bp · LXL04_013322|LXL04_013322|OH1004|cDNA
ATGGAAGAAGCTCAGAGGATGCTCAATCCATGGGTGCTTCATCTCCAAAAACTCGGCCTCGAGCTCAAATGCCCCCTCTGCCTTCAGCTGTTTAACCGCCCGCTGTTGCTCCCTTGCAATCACATTTTCTGCACTCTGTGTATGCCGAAAACAGGGGAGCTTGGGGCTGAGTGTCCAGCTTGTAAGCATCAGTACGTGGACCGAGAGGCTAAACCAGCGTCTTTCTTGGAGAACATTGTAAATATCTACAGGAATATTGA...
2250 bp · LXL04_013322|LXL04_013322|OH1004|CDS
ATGGAAGAAGCTCAGAGGATGCTCAATCCATGGGTGCTTCATCTCCAAAAACTCGGCCTCGAGCTCAAATGCCCCCTCTGCCTTCAGCTGTTTAACCGCCCGCTGTTGCTCCCTTGCAATCACATTTTCTGCACTCTGTGTATGCCGAAAACAGGGGAGCTTGGGGCTGAGTGTCCAGCTTGTAAGCATCAGTACGTGGACCGAGAGGCTAAACCAGCGTCTTTCTTGGAGAACATTGTAAATATCTACAGGAATATTGA...
Protein
Download Protein FASTA749 aa · LXL04_013322|LXL04_013322|OH1004|PROTEIN
MEEAQRMLNPWVLHLQKLGLELKCPLCLQLFNRPLLLPCNHIFCTLCMPKTGELGAECPACKHQYVDREAKPASFLENIVNIYRNIEATLNANLFHPVRSDVGRVSAHSPVSIKIDADSDSGNENVEIVQSRNSSNGQSTTSQTVKPSLLNTSTDDLVPRVSEKCITPESGQKQKFNIKDDQKPSHSNSICHVAPEKQIESVKHSPKREIENGAYERNSQTTEVKRQKKTSDELNDKSAVLDPMDSKRSPCAFCHSSKET...
Flanking Sequence Download
Sequence orientation and download details
Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.
ID Mapping
| Input ID | LXL04_013322 |
|---|---|
| TK1151 ID | TkA02G505300 |
| OH-1004 ID | LXL04_013322 |
| Relationship / confidence | Rbh High Identity Coverage Synteny / Strict |
| Protein identity (%) | 99.500 |
| Protein coverage (%) | TK1151 99.048 / OH-1004 83.311Coverage and evidenceCoverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation. |
| Source version | OH-1004 / GCA_047496595.1_OSU_TarKok_2.0 |
SNP / Indel variants and carrier samplesCRA009020 · OH-1004
Expand to load variant records for this gene.
Basic Information and Functional Annotation
| Gene ID | LXL04_013322 | |||||||||
|---|---|---|---|---|---|---|---|---|---|---|
| Location | Chr03:27769056-27774306 (+) | |||||||||
| Description | Similar to BARD1: BRCA1-associated RING domain protein 1 | |||||||||
| Arabidopsis / Rice Reference Genes and Papers |
Download references for this gene Arabidopsis
RiceNo hit for this species in the current source table. | |||||||||
| Functional annotation source | View annotation sourcesFunctional annotation source: OH1004 · | |||||||||
| GO annotations (OH1004 source) | GO:0000724 double-strand break repair via homologous recombination Biological Process GO:0006281 DNA repair Biological Process GO:0006282 regulation of DNA repair Biological Process GO:0006310 DNA recombination Biological Process GO:0006351 DNA-templated transcription Biological Process GO:0006974 DNA damage response Biological Process GO:0009934 regulation of meristem structural organization Biological Process GO:0010078 maintenance of root meristem identity Biological Process GO:0010332 response to gamma radiation Biological Process GO:0010492 maintenance of shoot apical meristem identity Biological Process GO:0035825 homologous recombination Biological Process GO:0042325 regulation of phosphorylation Biological Process | |||||||||
| KEGG gene cross-reference | ath:AT4G21070 mmu:12021 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene. |
Gene expression
View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.
Data sources and gene correspondence
Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.
Subcellular Localization Top 5
Computational predictions or homology annotations below do not replace localization experiments.
LocPro · Direct prediction · Computational prediction, not experimental localization
Predicted Functional Domains
Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.
PF13445.13zf-RING_UBOX24-48 aaPF13832.13zf-HC5HC2H_2278-367 aaPF13771.13zf-HC5HC2H289-367 aaPF00533.34BRCT405-478 aaPF16589.13BRCT_2414-490 aa| Gene ID | Domain ID | Domain Name | Start aa | End aa | E-value | Score |
|---|---|---|---|---|---|---|
| LXL04_013322 | PF13445.13 | zf-RING_UBOX | 24 | 48 | 1.4e-06 | 28.9 |
| LXL04_013322 | PF13832.13 | zf-HC5HC2H_2 | 278 | 367 | 6.9e-07 | 30.1 |
| LXL04_013322 | PF13771.13 | zf-HC5HC2H | 289 | 367 | 1.9e-10 | 41.5 |
| LXL04_013322 | PF00533.34 | BRCT | 405 | 478 | 1.4e-17 | 64.4 |
| LXL04_013322 | PF16589.13 | BRCT_2 | 414 | 490 | 5.5e-12 | 46.6 |
Arabidopsis / Rice Protein Homology
Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.