LXL04_013310 | RubberDandelionOmics

Gene overview

LXL04_013310

Reference: OH-1004 Chr: Chr03 Coordinates: 27500092-27504546 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1935 bp · LXL04_013310|LXL04_013310|OH1004|cDNA

ATGATTTCATTTATGTCTTCTGTGAAATCTCTTCTCCTGTCACCGATGGAGCGCTTGATCCATCCGGactttcttcaaatctttcaaaaAATGACACTCGTCAACAGGTTTCTCTTTCTGATAATGCATAGTATTGATAAGTCAGAGATGGGGTGGCACCGTTTGCCGGTGTTCTTGGGGCTAATATACCTGGCTATACGCCGGCATCTTCATGAGGAATACAATTTGATCAGCGTGGGTAAAACTCCGGTGGGGTTTCG...

CDS

Download CDS FASTA

1935 bp · LXL04_013310|LXL04_013310|OH1004|CDS

ATGATTTCATTTATGTCTTCTGTGAAATCTCTTCTCCTGTCACCGATGGAGCGCTTGATCCATCCGGACTTTCTTCAAATCTTTCAAAAAATGACACTCGTCAACAGGTTTCTCTTTCTGATAATGCATAGTATTGATAAGTCAGAGATGGGGTGGCACCGTTTGCCGGTGTTCTTGGGGCTAATATACCTGGCTATACGCCGGCATCTTCATGAGGAATACAATTTGATCAGCGTGGGTAAAACTCCGGTGGGGTTTCG...

Protein

Download Protein FASTA

644 aa · LXL04_013310|LXL04_013310|OH1004|PROTEIN

MISFMSSVKSLLLSPMERLIHPDFLQIFQKMTLVNRFLFLIMHSIDKSEMGWHRLPVFLGLIYLAIRRHLHEEYNLISVGKTPVGFRYSPSTELPFRAANGKIYDPFKDGAGSEGALFGRNMPSADHKDKQLKPHPMVVATKLLSRKQFKDTEKQFNMIAASWIQFMIHDWIDHLESTQQIELKAPIEVANECPLQSFKFYKTKEVDTGFPDIKKGHSNIRTPWWDGSVIYGSNSSKMRHVRTFKDGKLKIEKDGLLQHD...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_013310`
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_013310

Location Chr03:27500092-27504546 (+)

Description Similar to DOX1: Alpha-dioxygenase 1

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At3g01420`	Alpha-dioxygenase that catalyzes the primary oxygenation step of a variety of 14-20 carbon fatty acids, containing up to three unsaturated bonds, into their corresponding 2R-hydroperoxides.	alpha-oxidation of fatty acids in higher plants. Identification of a pathogen-inducible oxygenase (piox) as an alpha-dioxygenase and biosynthesis of 2-hydroperoxylinolenic acid.1999 · DOI: 10.1074/jbc.274.35.24503 Involvement of the Arabidopsis alpha-DOX1 fatty acid dioxygenase in protection against oxidative stress and cell death.2002 · DOI: 10.1046/j.1365-313x.2002.01195.x Role of 9-lipoxygenase and α-dioxygenase oxylipin pathways as modulators of local and systemic defense.2012 · DOI: 10.1093/mp/ssr105

Rice

Reference gene ID	Possible function	Papers / DOI
`Os12g0448900`	Alpha-dioxygenase that catalyzes the primary oxygenation step of a variety of 14-20 carbon fatty acids, containing up to three unsaturated bonds, into their corresponding 2R-hydroperoxides.	His-311 and Arg-559 are key residues involved in fatty acid oxygenation in pathogen-inducible oxygenase.2008 · DOI: 10.1074/jbc.m804358200

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_013310 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0001561 fatty acid alpha-oxidation Biological Process

GO:0001676 long-chain fatty acid metabolic process Biological Process

GO:0006629 lipid metabolic process Biological Process

GO:0006633 fatty acid biosynthetic process Biological Process

GO:0006952 defense response Biological Process

GO:0006979 response to oxidative stress Biological Process

GO:0009626 plant-type hypersensitive response Biological Process

GO:0009627 systemic acquired resistance Biological Process

GO:0009737 response to abscisic acid Biological Process

GO:0009751 response to salicylic acid Biological Process

GO:0031408 oxylipin biosynthetic process Biological Process

GO:0034614 cellular response to reactive oxygen species Biological Process

KEGG gene cross-reference

ag:CAH05011

ath:AT3G01420

osa:4352160

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.434

Rank 1 · LXL04_013310 · OH-1004

Mitochondrion0.174

Rank 2 · LXL04_013310 · OH-1004

Peroxisome0.150

Rank 3 · LXL04_013310 · OH-1004

Nucleus0.139

Rank 4 · LXL04_013310 · OH-1004

Endoplasmic reticulum0.134

Rank 5 · LXL04_013310 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF03098.21An_peroxidase96-613 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_013310	`PF03098.21`	An_peroxidase	96	613	1.6e-98	331.4

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9SGH6`	Arabidopsis thaliana	Alpha-dioxygenase 1	68.955%	Swiss-Prot	strong database homology
`Q2QRV3`	Oryza sativa subsp. japonica	Alpha-dioxygenase PIOX	62.562%	Swiss-Prot	strong database homology

JBrowse

View in Genome Browser

Gene Card