Gene Card
Gene overview
cDNA / CDS / Protein Sequences
657 bp · LXL04_013298|LXL04_013298|OH1004|cDNA
atgtttaaattttttttggacaaatacgatattttgaaagttaagaaggCTCGTCAATGTGCTGGATCACGTACATATGTAGACAAACGTGTGTACGATGAGTTTGTAGAAAAAGCAAAAACTCGTGCTTTACAACGAGTGGTTGGTGATCCATTTAAAGAGGGTGTCGAACAAGGTCCTCAGATTGATTCTGAACAATTTGAGAAAATCTTGAAGTACATAAGATCTGGTGTTGAAAATGGTGCAACCCTTGAAACTGG...
657 bp · LXL04_013298|LXL04_013298|OH1004|CDS
ATGTTTAAATTTTTTTTGGACAAATACGATATTTTGAAAGTTAAGAAGGCTCGTCAATGTGCTGGATCACGTACATATGTAGACAAACGTGTGTACGATGAGTTTGTAGAAAAAGCAAAAACTCGTGCTTTACAACGAGTGGTTGGTGATCCATTTAAAGAGGGTGTCGAACAAGGTCCTCAGATTGATTCTGAACAATTTGAGAAAATCTTGAAGTACATAAGATCTGGTGTTGAAAATGGTGCAACCCTTGAAACTGG...
Protein
Download Protein FASTA218 aa · LXL04_013298|LXL04_013298|OH1004|PROTEIN
MFKFFLDKYDILKVKKARQCAGSRTYVDKRVYDEFVEKAKTRALQRVVGDPFKEGVEQGPQIDSEQFEKILKYIRSGVENGATLETGGERFGSEGYYVQPTVFSNVQDNMLIAKDEIFGPVQSILKFKDIDEVIRRSNASQFGLAAGVFTQNLDTANTLTRALKAGTVWINCFDVFDAAIPFGGYKMSGHGREKGVYSLNSYLQVKAVVTHLKNPAWL
Flanking Sequence Download
Sequence orientation and download details
Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.
ID Mapping
| Input ID | LXL04_013298 |
|---|---|
| TK1151 ID | TkA02G507100 |
| OH-1004 ID | LXL04_013298 |
| Relationship / confidence | Rbh High Identity Coverage Synteny / Strict |
| Protein identity (%) | 99.500 |
| Protein coverage (%) | TK1151 100.000 / OH-1004 100.000Coverage and evidenceCoverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation. |
| Source version | OH-1004 / GCA_047496595.1_OSU_TarKok_2.0 |
SNP / Indel variants and carrier samplesCRA009020 · OH-1004
Expand to load variant records for this gene.
Basic Information and Functional Annotation
| Gene ID | LXL04_013298 | |||||||||
|---|---|---|---|---|---|---|---|---|---|---|
| Location | Chr03:27290166-27291164 (-) | |||||||||
| Description | Similar to ALDH2B7: Aldehyde dehydrogenase family 2 member B7, mitochondrial | |||||||||
| Arabidopsis / Rice Reference Genes and Papers |
Download references for this gene Arabidopsis
RiceNo hit for this species in the current source table. | |||||||||
| Functional annotation source | View annotation sourcesFunctional annotation source: OH1004 · | |||||||||
| GO annotations (OH1004 source) | GO:0002931 response to ischemia Biological Process GO:0006067 ethanol metabolic process Biological Process GO:0006068 ethanol catabolic process Biological Process GO:0006117 acetaldehyde metabolic process Biological Process GO:0007623 circadian rhythm Biological Process GO:0010597 green leaf volatile biosynthetic process Biological Process GO:0018937 nitroglycerin metabolic process Biological Process GO:0019752 carboxylic acid metabolic process Biological Process GO:0032355 response to estradiol Biological Process GO:0032496 response to lipopolysaccharide Biological Process GO:0032570 response to progesterone Biological Process GO:0032870 cellular response to hormone stimulus Biological Process | |||||||||
| KEGG gene cross-reference | ath:AT1G23800 ath:AT3G48000 mmu:11669 rno:29539 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene. |
Gene expression
View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.
Data sources and gene correspondence
Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.
Subcellular Localization Top 5
Computational predictions or homology annotations below do not replace localization experiments.
LocPro · Direct prediction · Computational prediction, not experimental localization
Predicted Functional Domains
Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.
PF00171.28Aldedh20-208 aa| Gene ID | Domain ID | Domain Name | Start aa | End aa | E-value | Score |
|---|---|---|---|---|---|---|
| LXL04_013298 | PF00171.28 | Aldedh | 20 | 208 | 2.4e-67 | 228.2 |
Arabidopsis / Rice Protein Homology
Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.