LXL04_013221 | RubberDandelionOmics

Gene overview

LXL04_013221

Reference: OH-1004 Chr: Chr03 Coordinates: 26216882-26220256 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1728 bp · LXL04_013221|LXL04_013221|OH1004|cDNA

TCCCAACACCACTTACACATATTTTTCAGAGAGCCGGATCCCCGAATATGCCGTTTTGATATTGAAAAAGACCGAACCGAGAGAAGCTTAAAAGTGACGCAGAAAACCCCCTTCCTTTTTCTGTTTATTTCCCAACGACTCCGCTTCTGCTCCAGTTTAGATTTTCAGTCTACGATGCCGGAAGGGACGACATCCATAGATTACGTAATGGAGGCCGCCTCTGGTCCTCATTTCTCCGGCCTACATCTTGATGCACAATT...

CDS

Download CDS FASTA

1608 bp · LXL04_013221|LXL04_013221|OH1004|CDS

CTGTTTATTTCCCAACGACTCCGCTTCTGCTCCAGTTTAGATTTTCAGTCTACGATGCCGGAAGGGACGACATCCATAGATTACGTAATGGAGGCCGCCTCTGGTCCTCATTTCTCCGGCCTACATCTTGATGCACAATTCCTCTCTTCTCCAAGATCTCTTTCCTCCTCCCAGCTTGCCGACTCAATCAAACAGCCTTTCGTCATAGGGGTTTCTGGAGGTACTGCTTCCGGTAAGACGACGGTTTGTGATATGATTAT...

Protein

Download Protein FASTA

535 aa · LXL04_013221|LXL04_013221|OH1004|PROTEIN

MFISQRLRFCSSLDFQSTMPEGTTSIDYVMEAASGPHFSGLHLDAQFLSSPRSLSSSQLADSIKQPFVIGVSGGTASGKTTVCDMIIQQLHDHRVVLVNQLGFCSMRIDAALSHMRLMLGVQLRNRGSTTGSAFCTLVLSLCLTGILCISVPNQLDSFYRGLTAEESERAHEYNFDHPDAFDTEQMLECVEKLKGGNSVHLPIYDFKNHRRCSESFRQVNASDVIILEGILVFHDQRVRDLMNMKIFVDTDADVRLARRI...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_013221`
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_013221

Location Chr03:26216882-26220256 (-)

Description Similar to UKL1: Uridine kinase-like protein 1, chloroplastic

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At5g40870`	Involved in the pyrimidine salvage pathway (Probable).	Functional characterization of a gene encoding a dual domain for uridine kinase and uracil phosphoribosyltransferase in Arabidopsis thaliana.2007 · DOI: 10.1007/s11103-006-9101-3 Plastid uridine salvage activity is required for photoassimilate allocation and partitioning in Arabidopsis.2011 · DOI: 10.1105/tpc.111.085829 Pyrimidine Salvage: Physiological Functions and Interaction with Chloroplast Biogenesis.2019 · DOI: 10.1104/pp.19.00329
`At3g27190`	Involved in the pyrimidine salvage pathway.	Plastid uridine salvage activity is required for photoassimilate allocation and partitioning in Arabidopsis.2011 · DOI: 10.1105/tpc.111.085829 Pyrimidine Salvage: Physiological Functions and Interaction with Chloroplast Biogenesis.2019 · DOI: 10.1104/pp.19.00329
`At4g26510`	Involved in the pyrimidine salvage pathway.	No verified direct reference in this release
`At1g55810`	Involved in the pyrimidine salvage pathway.	No verified direct reference in this release
`At3g27440`	Involved in the pyrimidine salvage pathway.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_013221 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0006207 'de novo' pyrimidine nucleobase biosynthetic process Biological Process

GO:0044206 UMP salvage Biological Process

GO:0044211 CTP salvage Biological Process

GO:0071456 cellular response to hypoxia Biological Process

GO:1901141 regulation of lignin biosynthetic process Biological Process

GO:2000904 regulation of starch metabolic process Biological Process

GO:2001006 regulation of cellulose biosynthetic process Biological Process

GO:0005634 nucleus Cellular Component

GO:0005737 cytoplasm Cellular Component

GO:0009507 chloroplast Cellular Component

GO:0004845 uracil phosphoribosyltransferase activity Molecular Function

GO:0004849 uridine kinase activity Molecular Function

KEGG gene cross-reference

ath:AT1G55810

ath:AT3G27190

ath:AT3G27440

ath:AT4G26510

ath:AT5G40870

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.479

Rank 1 · LXL04_013221 · OH-1004

Nucleus0.263

Rank 2 · LXL04_013221 · OH-1004

Mitochondrion0.190

Rank 3 · LXL04_013221 · OH-1004

Peroxisome0.097

Rank 4 · LXL04_013221 · OH-1004

Cell membrane0.066

Rank 5 · LXL04_013221 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00485.25PRK153-302 aa

PF14681.13UPRTase332-533 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_013221	`PF00485.25`	PRK	153	302	1.2e-42	146.7
LXL04_013221	`PF14681.13`	UPRTase	332	533	9.6e-75	251.3

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9FKS0`	Arabidopsis thaliana	Uridine/cytidine kinase UKL1, chloroplastic	71.561%	Swiss-Prot	strong database homology
`Q9LK34`	Arabidopsis thaliana	Uridine/cytidine kinase UKL1, chloroplastic	71.375%	Swiss-Prot	strong database homology
`O65583`	Arabidopsis thaliana	Uridine kinase-like protein 4	66.221%	Swiss-Prot	strong database homology
`Q8VYB2`	Arabidopsis thaliana	Uridine kinase-like protein 3	65.631%	Swiss-Prot	strong database homology
`Q9LTY6`	Arabidopsis thaliana	Uridine kinase-like protein 5	63.958%	Swiss-Prot	strong database homology

JBrowse

View in Genome Browser

Gene Card