LXL04_013220 | RubberDandelionOmics

Gene overview

LXL04_013220

Reference: OH-1004 Chr: Chr03 Coordinates: 26202215-26205881 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

2298 bp · LXL04_013220|LXL04_013220|OH1004|cDNA

ATGGAGACAACTTCTTACCAAATGGAAGAACATAAAAGAGAACCGATAATCAATTCTGTCCACCAACCACTCATCATCAGAAATCACAACCTTTCTTCCATCACCACTACCAAGAGTTCTCATATCGAAAGCTTGGATTATGAGATCAAcgagaatgatatgtttattcatgaccaaagaagcaaATCATATAATCTGTTCCTGAAATGGTTTCAAGCTTTCATGGTTGGCCTACTAACTGGTCTTACAGCCACTTTCAT...

CDS

Download CDS FASTA

2298 bp · LXL04_013220|LXL04_013220|OH1004|CDS

ATGGAGACAACTTCTTACCAAATGGAAGAACATAAAAGAGAACCGATAATCAATTCTGTCCACCAACCACTCATCATCAGAAATCACAACCTTTCTTCCATCACCACTACCAAGAGTTCTCATATCGAAAGCTTGGATTATGAGATCAACGAGAATGATATGTTTATTCATGACCAAAGAAGCAAATCATATAATCTGTTCCTGAAATGGTTTCAAGCTTTCATGGTTGGCCTACTAACTGGTCTTACAGCCACTTTCAT...

Protein

Download Protein FASTA

765 aa · LXL04_013220|LXL04_013220|OH1004|PROTEIN

METTSYQMEEHKREPIINSVHQPLIIRNHNLSSITTTKSSHIESLDYEINENDMFIHDQRSKSYNLFLKWFQAFMVGLLTGLTATFINIAVENIAGYKLLAVFHFITEKRYMTGFFFTAGVNFLLTLVATVLCVFFAPTAAGPGVPEIKAYLNGIDTPNMYGATTMFVKIIGSIGAVSAGLDLGKEGPLIHIGACIASIIGQRGSDRNRRDIITCGASSGVCAAFRAPVGGVLFSLEEVATWWRSALLWRTFFSTAVVVV...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_013220`
TK1151 ID	TkA02G511010
OH-1004 ID	LXL04_013220
Relationship / confidence	Rbh Sequence Supported / Probable
Protein identity (%)	98.900
Protein coverage (%)	TK1151 99.821 / OH-1004 72.941 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_013220

Location Chr03:26202215-26205881 (+)

Description Similar to CLC-A: Chloride channel protein CLC-a

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At5g40890`	Voltage-gated chloride channel that could play a role in the regulation of nitrate content.	Disruption of putative anion channel gene AtCLC-a in Arabidopsis suggests a role in the regulation of nitrate content.2000 · DOI: 10.1046/j.1365-313x.2000.00680.x
`At3g27170`	Voltage-gated chloride channel.	No verified direct reference in this release
`At5g49890`	Voltage-gated chloride channel.	No verified direct reference in this release
`At5g33280`	Putative voltage-gated chloride channel.	No verified direct reference in this release
`At5g26240`	Voltage-gated chloride channel.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_013220 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0006821 chloride transport Biological Process

GO:0009826 unidimensional cell growth Biological Process

GO:0010167 response to nitrate Biological Process

GO:0015706 nitrate transmembrane transport Biological Process

GO:0045824 negative regulation of innate immune response Biological Process

GO:0000325 plant-type vacuole Cellular Component

GO:0005634 nucleus Cellular Component

GO:0005802 trans-Golgi network Cellular Component

GO:0009507 chloroplast Cellular Component

GO:0009536 plastid Cellular Component

GO:0009705 plant-type vacuole membrane Cellular Component

GO:0034707 chloride channel complex Cellular Component

KEGG gene cross-reference

ath:AT3G27170

ath:AT5G26240

ath:AT5G33280

ath:AT5G40890

ath:AT5G49890

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Lysosome / Vacuole0.324

Rank 1 · LXL04_013220 · OH-1004

Cell membrane0.316

Rank 2 · LXL04_013220 · OH-1004

Cytoplasm0.169

Rank 3 · LXL04_013220 · OH-1004

Endoplasmic reticulum0.154

Rank 4 · LXL04_013220 · OH-1004

Golgi apparatus0.108

Rank 5 · LXL04_013220 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00654.26Voltage_CLC126-525 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_013220	`PF00654.26`	Voltage_CLC	126	525	1.9e-71	241.8

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`P92941`	Arabidopsis thaliana	Chloride channel protein CLC-a	66.844%	Swiss-Prot	strong database homology
`P92942`	Arabidopsis thaliana	Chloride channel protein CLC-b	67.068%	Swiss-Prot	strong database homology
`Q96282`	Arabidopsis thaliana	Chloride channel protein CLC-c	50.475%	Swiss-Prot	strong database homology
`P60300`	Arabidopsis thaliana	Putative chloride channel-like protein CLC-g	49.041%	Swiss-Prot	moderate database homology
`P92943`	Arabidopsis thaliana	Chloride channel protein CLC-d	44.832%	Swiss-Prot	moderate database homology

JBrowse

View in Genome Browser

Gene Card