LXL04_013202 | RubberDandelionOmics

Gene overview

LXL04_013202

Reference: OH-1004 Chr: Chr03 Coordinates: 25877770-25886516 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

588 bp · LXL04_013202|LXL04_013202|OH1004|cDNA

ATGGGGAGAGGGAAGGTCGAGCTCAAGCGGATCGAAGACAAAAGCAGCCGTCAGGTGTCGTTCTCTAAGCGACGGAATGGATTGATGAAGAAATCTTATGAGCTATCGGTGCTGTGTGAAGTCGACGTCGCTCTTTTCATTTTCTCCGGCAAAGGCAGACTCTATGAGTTCTCGACTGATGAAAGCATGACCAGGATTCTGAGCAGCTACCAGAGCTACAAGCAAACAGAGGAGCTTACCCGCGTAAACATACACGAGAA...

CDS

Download CDS FASTA

588 bp · LXL04_013202|LXL04_013202|OH1004|CDS

ATGGGGAGAGGGAAGGTCGAGCTCAAGCGGATCGAAGACAAAAGCAGCCGTCAGGTGTCGTTCTCTAAGCGACGGAATGGATTGATGAAGAAATCTTATGAGCTATCGGTGCTGTGTGAAGTCGACGTCGCTCTTTTCATTTTCTCCGGCAAAGGCAGACTCTATGAGTTCTCGACTGATGAAAGCATGACCAGGATTCTGAGCAGCTACCAGAGCTACAAGCAAACAGAGGAGCTTACCCGCGTAAACATACACGAGAA...

Protein

Download Protein FASTA

195 aa · LXL04_013202|LXL04_013202|OH1004|PROTEIN

MGRGKVELKRIEDKSSRQVSFSKRRNGLMKKSYELSVLCEVDVALFIFSGKGRLYEFSTDESMTRILSSYQSYKQTEELTRVNIHEKLASEYTDLSTADELTEMIQRHLDEISLKKLEISGLNQLERELHNLLRVVRVRKTQLMMGVVKNLQKQEMELKKEKKMMMNEIMAAKLKEMDHDGDAGAHDAMTDVEIT

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_013202`
TK1151 ID	TkA02G512510
OH-1004 ID	LXL04_013202
Relationship / confidence	Rbh High Identity Coverage Synteny / Strict
Protein identity (%)	96.900
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_013202

Location Chr03:25877770-25886516 (+)

Description Similar to AP1: Agamous-like MADS-box protein AP1

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At1g26310`	Probable transcription factor that promotes early floral meristem identity in synergy with APETALA1, FRUITFULL and LEAFY.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_013202 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0006351 DNA-templated transcription Biological Process

GO:0006357 regulation of transcription by RNA polymerase II Biological Process

GO:0009908 flower development Biological Process

GO:0009911 positive regulation of flower development Biological Process

GO:0010582 floral meristem determinacy Biological Process

GO:0030154 cell differentiation Biological Process

GO:0045944 positive regulation of transcription by RNA polymerase II Biological Process

GO:0048440 carpel development Biological Process

GO:0005634 nucleus Cellular Component

GO:0000977 RNA polymerase II transcription regulatory region sequence-specific DNA binding Molecular Function

GO:0000978 RNA polymerase II cis-regulatory region sequence-specific DNA binding Molecular Function

GO:0000981 DNA-binding transcription factor activity, RNA polymerase II-specific Molecular Function

KEGG gene cross-reference

ath:AT1G26310

sly:101263981

vvi:100232952

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.973

Rank 1 · LXL04_013202 · OH-1004

Cytoplasm0.085

Rank 2 · LXL04_013202 · OH-1004

Cell membrane0.017

Rank 3 · LXL04_013202 · OH-1004

Endoplasmic reticulum0.010

Rank 4 · LXL04_013202 · OH-1004

Plastid0.008

Rank 5 · LXL04_013202 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00319.24SRF-TF10-57 aa

PF01486.23K-box83-168 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_013202	`PF00319.24`	SRF-TF	10	57	5.6e-24	84.0
LXL04_013202	`PF01486.23`	K-box	83	168	3.9e-09	37.3

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q39081`	Arabidopsis thaliana	Transcription factor CAULIFLOWER	41.954%	Swiss-Prot	moderate database homology

JBrowse

View in Genome Browser

Gene Card