LXL04_013168 | RubberDandelionOmics

Gene overview

LXL04_013168

Reference: OH-1004 Chr: Chr03 Coordinates: 25295748-25298376 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1482 bp · LXL04_013168|LXL04_013168|OH1004|cDNA

ATGACAAGACCGCTGAAACCCTCATCAAGAAGACCCGCATTTCTTCATCTCATCTGCGCTGCGACCGCTTTCTCTCTCATTGTTTTCGCCATTCAATCATTTTTCTTCACTGGTACTCGAACCAGTACTCTGAACAGAGAAGACGTCCAGATCTTATCCGATTTTCAGGCCGACGTTCAGCAGTGCGTGGCAAACAGAGGATTTGGACTTACTGCACAAATCATCGACCACTGCAAGTTGGTTCTCAAGTTTCCCGAAGG...

CDS

Download CDS FASTA

1482 bp · LXL04_013168|LXL04_013168|OH1004|CDS

ATGACAAGACCGCTGAAACCCTCATCAAGAAGACCCGCATTTCTTCATCTCATCTGCGCTGCGACCGCTTTCTCTCTCATTGTTTTCGCCATTCAATCATTTTTCTTCACTGGTACTCGAACCAGTACTCTGAACAGAGAAGACGTCCAGATCTTATCCGATTTTCAGGCCGACGTTCAGCAGTGCGTGGCAAACAGAGGATTTGGACTTACTGCACAAATCATCGACCACTGCAAGTTGGTTCTCAAGTTTCCCGAAGG...

Protein

Download Protein FASTA

493 aa · LXL04_013168|LXL04_013168|OH1004|PROTEIN

MTRPLKPSSRRPAFLHLICAATAFSLIVFAIQSFFFTGTRTSTLNREDVQILSDFQADVQQCVANRGFGLTAQIIDHCKLVLKFPEGTNSTWLNPQFKTYEPLEYKYDVCEAVLLWEQYRNMTTVLTREYLDARPDGWMDYAAKRIAQLGAKDCSNRTLCEELLNPMLPAKPPFHPRQFERCAVVGNSGDLLKTEFGEEIDSHDAVIRDNEAPVNQKYAKHVGLKRDFRLGVRGTARNMVTILNGSDDEVFVIKSVTHRD...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_013168`
TK1151 ID	TkA02G513720
OH-1004 ID	LXL04_013168
Relationship / confidence	Rbh Below Probable Coverage Or Synteny Threshold / Review
Protein identity (%)	77.400
Protein coverage (%)	TK1151 95.696 / OH-1004 92.292 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_013168

Location Chr03:25295748-25298376 (+)

Description Similar to SIA1: Sialyltransferase-like protein 1

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At1g08660`	Required for normal pollen grain germination and pollen tube growth.	MALE GAMETOPHYTE DEFECTIVE 2, encoding a sialyltransferase-like protein, is required for normal pollen germination and pollen tube growth in Arabidopsis.2010 · DOI: 10.1111/j.1744-7909.2010.00963.x
`At3g48820`	May participate in glycosyl transfer during cell-wall rhamnogalacturonan II biosynthesis.	The Arabidopsis thaliana putative sialyltransferase resides in the Golgi apparatus but lacks the ability to transfer sialic acid.2009 · DOI: 10.1111/j.1438-8677.2008.00138.x The cell wall pectic polymer rhamnogalacturonan-II is required for proper pollen tube elongation: implications of a putative sialyltransferase-like protein.2014 · DOI: 10.1093/aob/mcu093

Rice

Reference gene ID	Possible function	Papers / DOI
`Os11g0572400`	May possess sialyltransferase-like activity in vitro.	No verified direct reference in this release
`Os02g0118400`	May possess sialyltransferase-like activity in vitro.	No verified direct reference in this release

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_013168 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0001574 ganglioside biosynthetic process Biological Process

GO:0001576 globoside biosynthetic process Biological Process

GO:0009101 glycoprotein biosynthetic process Biological Process

GO:0009247 glycolipid biosynthetic process Biological Process

GO:0009312 oligosaccharide biosynthetic process Biological Process

GO:0009846 pollen germination Biological Process

GO:0009860 pollen tube growth Biological Process

GO:0097503 sialylation Biological Process

GO:0000138 Golgi trans cisterna Cellular Component

GO:0000139 Golgi membrane Cellular Component

GO:0005576 extracellular region Cellular Component

GO:0005768 endosome Cellular Component

KEGG gene cross-reference

ath:AT1G08660

ath:AT3G48820

dosa:Os02g0118400

dosa:Os11g0572400

rno:64442

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Golgi apparatus0.753

Rank 1 · LXL04_013168 · OH-1004

Endoplasmic reticulum0.110

Rank 2 · LXL04_013168 · OH-1004

Cytoplasm0.085

Rank 3 · LXL04_013168 · OH-1004

Cell membrane0.076

Rank 4 · LXL04_013168 · OH-1004

Extracellular0.065

Rank 5 · LXL04_013168 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00777.24Glyco_transf_29155-264 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_013168	`PF00777.24`	Glyco_transf_29	155	264	8e-26	91.7

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q8VZJ0`	Arabidopsis thaliana	Sialyltransferase-like protein 1	75.497%	Swiss-Prot	strong database homology
`Q8RY00`	Arabidopsis thaliana	Sialyltransferase-like protein 2	46.043%	Swiss-Prot	moderate database homology
`Q2R2B1`	Oryza sativa subsp. japonica	Sialyltransferase-like protein 5	74.769%	Swiss-Prot	strong database homology
`Q6ZH45`	Oryza sativa subsp. japonica	Sialyltransferase-like protein 4	44.027%	Swiss-Prot	moderate database homology

JBrowse

View in Genome Browser

Gene Card