LXL04_013149 | RubberDandelionOmics

Gene overview

LXL04_013149

Reference: OH-1004 Chr: Chr03 Coordinates: 24892616-24894935 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1493 bp · LXL04_013149|LXL04_013149|OH1004|cDNA

TGAACCCCATCTGCACCCTTCCTCTCTTCAAAAACAACAATTTATTCTCTCACCTCTTCATCTTCCCCCCTCCTATCTCTCAAGTCTCAATCTCCTCTCCTACAATGGAACCACCATGGATTGATGACCTCTCCGATGACCTCCAGAGCATTAGCTTCAACTCCACAACCACCACTACTGCTACCGATATCAACCGTAGCACTAGCTCTGGCTCCGAAACCACTTGGACGACAGCTACCTACTCCGCACGGCATAACCCC...

CDS

Download CDS FASTA

1389 bp · LXL04_013149|LXL04_013149|OH1004|CDS

ATGGAACCACCATGGATTGATGACCTCTCCGATGACCTCCAGAGCATTAGCTTCAACTCCACAACCACCACTACTGCTACCGATATCAACCGTAGCACTAGCTCTGGCTCCGAAACCACTTGGACGACAGCTACCTACTCCGCACGGCATAACCCCTCCACTACTGTCAAATCCACAGCTCATTCTGGTAACCCGTATTGGGACGCAATCCGGCTCGCAGGATCTGAATCCGGTAGTAATCTCTCCCTCACTGACCTTCG...

Protein

Download Protein FASTA

462 aa · LXL04_013149|LXL04_013149|OH1004|PROTEIN

MEPPWIDDLSDDLQSISFNSTTTTTATDINRSTSSGSETTWTTATYSARHNPSTTVKSTAHSGNPYWDAIRLAGSESGSNLSLTDLRFIQRLGAGDIGSVYLSEIKRSSSSSSSAAVFAAKVMDKRELASRNKEGRAKTEKEILEMLDHPFLPTLYASLESPKWSCLLTEFCPGGDLHVLRQRQPCKRFPESAVRFYASEVVVALEYLHMLDIVYRDLKPENVLVRSDGHIMLTDFDLSLKCDVSTSTPAQVYSDHNRPN...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_013149`
TK1151 ID	TkA01G128750
OH-1004 ID	LXL04_013149
Relationship / confidence	Non Reciprocal Best Hit / Complex relationship
Protein identity (%)	72.100
Protein coverage (%)	TK1151 86.099 / OH-1004 40.693 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_013149

Location Chr03:24892616-24894935 (+)

Description Similar to D6PKL2: Serine/threonine-protein kinase D6PKL2

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At5g47750`	Protein kinase that regulates the auxin transport activity of PIN auxin efflux facilitators by direct phosphorylation.	D6PK AGCVIII kinases are required for auxin transport and phototropic hypocotyl bending in Arabidopsis.2013 · DOI: 10.1105/tpc.113.111484
`At5g55910`	Protein kinase that regulates the auxin transport activity of PIN auxin efflux facilitators by direct phosphorylation.	The polarly localized D6 PROTEIN KINASE is required for efficient auxin transport in Arabidopsis thaliana.2009 · DOI: 10.1242/dev.028365 D6PK AGCVIII kinases are required for auxin transport and phototropic hypocotyl bending in Arabidopsis.2013 · DOI: 10.1105/tpc.113.111484 Arabidopsis D6PK is a lipid domain-dependent mediator of root epidermal planar polarity.2015 · DOI: 10.1038/nplants.2015.162
`At3g27580`	Protein kinase that regulates the auxin transport activity of PIN auxin efflux facilitators by direct phosphorylation.	D6PK AGCVIII kinases are required for auxin transport and phototropic hypocotyl bending in Arabidopsis.2013 · DOI: 10.1105/tpc.113.111484

Rice

Reference gene ID	Possible function	Papers / DOI
`Os06g0291600`	May play a role in the regulation of metabolism and signal transduction processes.	No verified direct reference in this release
`UniProt: A2YBX5`	May play a role in the regulation of metabolism and signal transduction processes.	No verified direct reference in this release

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_013149 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0006468 protein phosphorylation Biological Process

GO:0009555 pollen development Biological Process

GO:0009630 gravitropism Biological Process

GO:0009638 phototropism Biological Process

GO:0009734 auxin-activated signaling pathway Biological Process

GO:0010540 basipetal auxin transport Biological Process

GO:0048766 root hair initiation Biological Process

GO:0062075 pollen aperture formation Biological Process

GO:2000114 regulation of establishment of cell polarity Biological Process

GO:0005634 nucleus Cellular Component

GO:0005730 nucleolus Cellular Component

GO:0005737 cytoplasm Cellular Component

KEGG gene cross-reference

ath:AT3G27580

ath:AT5G47750

ath:AT5G55910

dosa:Os06g0291600

osa:4340792

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.578

Rank 1 · LXL04_013149 · OH-1004

Nucleus0.461

Rank 2 · LXL04_013149 · OH-1004

Cell membrane0.077

Rank 3 · LXL04_013149 · OH-1004

Mitochondrion0.042

Rank 4 · LXL04_013149 · OH-1004

Endoplasmic reticulum0.037

Rank 5 · LXL04_013149 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF07714.24PK_Tyr_Ser-Thr87-242 aa

PF00069.32Pkinase88-250 aa

PF00069.32Pkinase320-423 aa

PF07714.24PK_Tyr_Ser-Thr328-407 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_013149	`PF07714.24`	PK_Tyr_Ser-Thr	87	242	1.3e-26	94.2
LXL04_013149	`PF00069.32`	Pkinase	88	250	4.5e-52	177.8
LXL04_013149	`PF00069.32`	Pkinase	320	423	4.5e-52	177.8
LXL04_013149	`PF07714.24`	PK_Tyr_Ser-Thr	328	407	1.3e-26	94.2

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q39183`	Arabidopsis thaliana	Serine/threonine-protein kinase D6PKL2	55.388%	Swiss-Prot	strong database homology
`Q9FG74`	Arabidopsis thaliana	Serine/threonine-protein kinase D6PK	50.542%	Swiss-Prot	strong database homology
`Q05999`	Arabidopsis thaliana	Serine/threonine-protein kinase D6PKL3	55.440%	Swiss-Prot	strong database homology
`Q0DCT8`	Oryza sativa subsp. japonica	Protein kinase G11A	55.556%	Swiss-Prot	strong database homology
`A2YBX5`	Oryza sativa subsp. indica	Protein kinase G11A	55.556%	Swiss-Prot	strong database homology

JBrowse

View in Genome Browser

Gene Card