LXL04_013137 | RubberDandelionOmics

Gene overview

LXL04_013137

Reference: OH-1004 Chr: Chr03 Coordinates: 24652334-24653644 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1311 bp · LXL04_013137|LXL04_013137|OH1004|cDNA

ATGCAGTGTGTTGCTCCTTCATCGAGTATTAGTTTCAAGTCCATAATGGGCACGCCGGCGTTGTTGCCATTACAGACGGTTTCCCACCGAATCGCTCAGCCGAGTCAGCTCGCCGTTCAATGTGTGGCAAGCCGTTTTGACGCAGCGGCAGCCAACGCTACCAATCTTCCTCTGTCGGCGGCTGTGCCGACCACCAACAACTTCGCATATGGAGGAGTTGTTAAGAGCCGAACCGATTGGCAGAGCTCGTGCGCGATTTT...

CDS

Download CDS FASTA

1311 bp · LXL04_013137|LXL04_013137|OH1004|CDS

ATGCAGTGTGTTGCTCCTTCATCGAGTATTAGTTTCAAGTCCATAATGGGCACGCCGGCGTTGTTGCCATTACAGACGGTTTCCCACCGAATCGCTCAGCCGAGTCAGCTCGCCGTTCAATGTGTGGCAAGCCGTTTTGACGCAGCGGCAGCCAACGCTACCAATCTTCCTCTGTCGGCGGCTGTGCCGACCACCAACAACTTCGCATATGGAGGAGTTGTTAAGAGCCGAACCGATTGGCAGAGCTCGTGCGCGATTTT...

Protein

Download Protein FASTA

436 aa · LXL04_013137|LXL04_013137|OH1004|PROTEIN

MQCVAPSSSISFKSIMGTPALLPLQTVSHRIAQPSQLAVQCVASRFDAAAANATNLPLSAAVPTTNNFAYGGVVKSRTDWQSSCAILASKVVSQQNTEKSNGADKITVVNGHSSLDLVPIDKLPKPLTIADLSPAPLHGSTLRVAYQGVAGAYSEAAAGKAYPNCEAIPCDQFEVAFQAVELWIADRAVLPVENSLGGSIHRNYDLLLRHKLHIVGEVQLSVHHCLLALPGVRKEYLNRVISHPQALSQCELTLTKLGLT...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_013137`
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_013137

Location Chr03:24652334-24653644 (-)

Description Similar to ADT6: Arogenate dehydratase/prephenate dehydratase 6, chloroplastic

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At1g08250`	Converts the prephenate produced from the shikimate- chorismate pathway into phenylalanine.	Phenylalanine biosynthesis in Arabidopsis thaliana. Identification and characterization of arogenate dehydratases.2007 · DOI: 10.1074/jbc.m702662200
`At2g27820`	Converts the prephenate produced from the shikimate- chorismate pathway into phenylalanine.	Phenylalanine biosynthesis in Arabidopsis thaliana. Identification and characterization of arogenate dehydratases.2007 · DOI: 10.1074/jbc.m702662200
`At3g44720`	Converts the prephenate produced from the shikimate-chorismate pathway into phenylalanine.	Phenylalanine biosynthesis in Arabidopsis thaliana. Identification and characterization of arogenate dehydratases.2007 · DOI: 10.1074/jbc.m702662200

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_013137 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0006571 L-tyrosine biosynthetic process Biological Process

GO:0006952 defense response Biological Process

GO:0007623 circadian rhythm Biological Process

GO:0009094 L-phenylalanine biosynthetic process Biological Process

GO:0010244 response to low fluence blue light stimulus by blue low-fluence system Biological Process

GO:0005737 cytoplasm Cellular Component

GO:0005829 cytosol Cellular Component

GO:0009507 chloroplast Cellular Component

GO:0009570 chloroplast stroma Cellular Component

GO:0004664 prephenate dehydratase activity Molecular Function

GO:0047769 arogenate dehydratase activity Molecular Function

KEGG gene cross-reference

ath:AT1G08250

ath:AT2G27820

ath:AT3G44720

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Plastid0.960

Rank 1 · LXL04_013137 · OH-1004

Mitochondrion0.057

Rank 2 · LXL04_013137 · OH-1004

Cytoplasm0.031

Rank 3 · LXL04_013137 · OH-1004

Nucleus0.026

Rank 4 · LXL04_013137 · OH-1004

Peroxisome0.018

Rank 5 · LXL04_013137 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00800.24PDT144-321 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_013137	`PF00800.24`	PDT	144	321	1.4e-58	198.4

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9SGD6`	Arabidopsis thaliana	Arogenate dehydratase/prephenate dehydratase 6, chloroplastic	78.571%	Swiss-Prot	strong database homology
`Q9ZUY3`	Arabidopsis thaliana	Arogenate dehydratase 3, chloroplastic	78.237%	Swiss-Prot	strong database homology
`O22241`	Arabidopsis thaliana	Arogenate dehydratase 4, chloroplastic	68.957%	Swiss-Prot	strong database homology

JBrowse

View in Genome Browser

Gene Card