LXL04_013077 | RubberDandelionOmics

Gene overview

LXL04_013077

Reference: OH-1004 Chr: Chr03 Coordinates: 23593559-23596849 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

2298 bp · LXL04_013077|LXL04_013077|OH1004|cDNA

ATGACCACATCGccctcgtcttcttcttcttctgattcttGTTTTTCTACTACTGATCGTCATCGTTATAATAACGAGGTTCGCTTATTCAAATGGCGATTTCTAACCTCTTCCGAAGAACCTATTGCATTGATCTTGGTGGAGGATGATTTCGGTGGCGATGAGGAAAAAGAAGGGAATGAAGAATTGTCATTTAGGTACACACGTCATGTTCTTCAGAGCACTTTGCAGTTGATGGGCTGTAAAGCACGTCACGCCTT...

CDS

Download CDS FASTA

2298 bp · LXL04_013077|LXL04_013077|OH1004|CDS

ATGACCACATCGCCCTCGTCTTCTTCTTCTTCTGATTCTTGTTTTTCTACTACTGATCGTCATCGTTATAATAACGAGGTTCGCTTATTCAAATGGCGATTTCTAACCTCTTCCGAAGAACCTATTGCATTGATCTTGGTGGAGGATGATTTCGGTGGCGATGAGGAAAAAGAAGGGAATGAAGAATTGTCATTTAGGTACACACGTCATGTTCTTCAGAGCACTTTGCAGTTGATGGGCTGTAAAGCACGTCACGCCTT...

Protein

Download Protein FASTA

765 aa · LXL04_013077|LXL04_013077|OH1004|PROTEIN

MTTSPSSSSSSDSCFSTTDRHRYNNEVRLFKWRFLTSSEEPIALILVEDDFGGDEEKEGNEELSFRYTRHVLQSTLQLMGCKARHAFKISQRVFEIMRTECLGDTLAAMGVIKTGKDFLKVHPGKESSRVTESQPEKEGESSNTVSKNDDKIRSIPFESYKKRTTVIVKRRRFIDVVCDALAEYKYVGPNQRADLVLACRIRERKESVTVLLCGTSGCGKSTLSALLASRLGITTVVSTDSIRHMMRSFVDEKQNPLLWS...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_013077`
TK1151 ID	TkA02G518630
OH-1004 ID	LXL04_013077
Relationship / confidence	Rbh High Identity Coverage Synteny / Strict
Protein identity (%)	99.400
Protein coverage (%)	TK1151 99.314 / OH-1004 94.641 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_013077

Location Chr03:23593559-23596849 (+)

Description Similar to At5g60760: P-loop NTPase domain-containing protein LPA1 homolog 1

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At5g60760`	Required for the accumulation of phytic acid in seeds.	Genetic analysis of two OsLpa1-like genes in Arabidopsis reveals that only one is required for wild-type seed phytic acid levels.2010 · DOI: 10.1007/s00425-010-1243-5
`At3g45090`	May be not required for the accumulation of phytic acid in seeds.	Genetic analysis of two OsLpa1-like genes in Arabidopsis reveals that only one is required for wild-type seed phytic acid levels.2010 · DOI: 10.1007/s00425-010-1243-5

Rice

Reference gene ID	Possible function	Papers / DOI
`Os02g0819400`	Required for the accumulation of phytic acid in seeds.	The rice OsLpa1 gene encodes a novel protein involved in phytic acid metabolism.2008 · DOI: 10.1007/s00122-008-0818-z
`Os09g0572200`	Required for the accumulation of phytic acid in seeds.	No verified direct reference in this release

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_013077 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0010264 myo-inositol hexakisphosphate biosynthetic process Biological Process

GO:0005634 nucleus Cellular Component

KEGG gene cross-reference

ath:AT3G45090

ath:AT5G60760

ddi:DDB_G0273453

ddi:DDB_G0273565

dosa:Os02g0819400

dosa:Os09g0572200

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.408

Rank 1 · LXL04_013077 · OH-1004

Cytoplasm0.406

Rank 2 · LXL04_013077 · OH-1004

Cell membrane0.146

Rank 3 · LXL04_013077 · OH-1004

Golgi apparatus0.072

Rank 4 · LXL04_013077 · OH-1004

Endoplasmic reticulum0.066

Rank 5 · LXL04_013077 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF28345.1LPA1_N54-204 aa

PF13238.13AAA_18210-247 aa

PF13671.13AAA_33210-256 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_013077	`PF28345.1`	LPA1_N	54	204	2.7e-56	190.3
LXL04_013077	`PF13238.13`	AAA_18	210	247	4e-07	31.3
LXL04_013077	`PF13671.13`	AAA_33	210	256	9e-07	30.0

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9FJH9`	Arabidopsis thaliana	P-loop NTPase domain-containing protein LPA1 homolog 1	62.347%	Swiss-Prot	strong database homology
`Q93ZS1`	Arabidopsis thaliana	P-loop NTPase domain-containing protein LPA1 homolog 2	62.517%	Swiss-Prot	strong database homology
`B9F4I8`	Oryza sativa subsp. japonica	P-loop NTPase domain-containing protein LPA1	65.576%	Swiss-Prot	strong database homology
`Q651A1`	Oryza sativa subsp. japonica	P-loop NTPase domain-containing protein LPA1 homolog	60.245%	Swiss-Prot	strong database homology

JBrowse

View in Genome Browser

Gene Card