LXL04_013060 | RubberDandelionOmics

Gene overview

LXL04_013060

Reference: OH-1004 Chr: Chr03 Coordinates: 23372478-23373566 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

655 bp · LXL04_013060|LXL04_013060|OH1004|cDNA

ATGGGCTGCAGactgcaagttctgagtaaaTGTGAAGATCCCTGCAAAAAACCACTTCACTTTGATGATGGGTTTGCTTTTGATCAAGGAAATGTTGAAAGAAAGACAAACATTTCACAATAGGAGTTCCTTCAGCAGTATGATGCACATAAACCTGGAGACACATTTCAAAATATCTTAGAGGACTTCTTCCGAAATGGCTGCTTCTTGTGATGGCACAGTTCACATATGGAATAGCCGATCAGGAAATGGCATATCCG...

CDS

Download CDS FASTA

459 bp · LXL04_013060|LXL04_013060|OH1004|CDS

ATGGCTGCTTCTTGTGATGGCACAGTTCACATATGGAATAGCCGATCAGGAAATGGCATATCCGTCATTTCCGAAAGTTCTGGACAATATGGAACATCAAGTAGAAATTCAGATCAAGCTAATATGCTGGATTTTTGCTCACTTAGAAGTGGGTTTTTAAGCAATACCTATGATGCGAGAGTATATACTTGTACGCATCACTTGGAAACTCTAAATAGGCTTTTGACACGTACTGGAAACGGTTCTCTCAGGCTGCTTGA...

Protein

Download Protein FASTA

152 aa · LXL04_013060|LXL04_013060|OH1004|PROTEIN

MAASCDGTVHIWNSRSGNGISVISESSGQYGTSSRNSDQANMLDFCSLRSGFLSNTYDARVYTCTHHLETLNRLLTRTGNGSLRLLDSRSGNLINSWQAHDGYVTKVWFCFQILSCRFYFMLYIWVFSSLNFNLFTLYTPHGKSFNTPKRCR

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_013060`
TK1151 ID	TkAUNG050200
OH-1004 ID	LXL04_013060
Relationship / confidence	Non Reciprocal Best Hit / Complex relationship
Protein identity (%)	54.300
Protein coverage (%)	TK1151 95.413 / OH-1004 69.079 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_013060

Location Chr03:23372478-23373566 (-)

Description Similar to GFS12: Protein GFS12

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At5g18525`	May act predominantly to suppress BCHC1, which itself is a negative factor in protein storage vacuole (PSV) trafficking regulation and plant effector triggered immunity (ETI).	BEACH-domain proteins act together in a cascade to mediate vacuolar protein trafficking and disease resistance in Arabidopsis.2015 · DOI: 10.1016/j.molp.2014.11.015

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_013060 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0006623 protein targeting to vacuole Biological Process

GO:0042742 defense response to bacterium Biological Process

GO:2000643 positive regulation of early endosome to late endosome transport Biological Process

GO:0005737 cytoplasm Cellular Component

GO:0005769 early endosome Cellular Component

GO:0005770 late endosome Cellular Component

GO:0080008 Cul4-RING E3 ubiquitin ligase complex Cellular Component

GO:0004672 protein kinase activity Molecular Function

GO:0005524 ATP binding Molecular Function

KEGG gene cross-reference

ath:AT5G18525

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.536

Rank 1 · LXL04_013060 · OH-1004

Cytoplasm0.387

Rank 2 · LXL04_013060 · OH-1004

Mitochondrion0.082

Rank 3 · LXL04_013060 · OH-1004

Cell membrane0.041

Rank 4 · LXL04_013060 · OH-1004

Endoplasmic reticulum0.039

Rank 5 · LXL04_013060 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

No result was found for this query.

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`F4JY12`	Arabidopsis thaliana	Protein GFS12	37.755%	Swiss-Prot	moderate database homology

JBrowse

View in Genome Browser

Gene Card