LXL04_012990 | RubberDandelionOmics

Gene overview

LXL04_012990

Reference: OH-1004 Chr: Chr03 Coordinates: 22006151-22006871 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

555 bp · LXL04_012990|LXL04_012990|OH1004|cDNA

ATGTGGGACGCATTCAGCTCACCACCGTCTCTACTAATCCACAAAAAGCTTCGGATTTTCATTCAGATCTCCGATCAATCGCTTCCGgttcttccttcttttctctCCTCCTCATCCTCGTCGCCCTCATCTCCATCGCCACCGCCGAGATTCGTTTCATGGCTTCAGGTTCTCCAACAGATCGAAGACGGGGAGATAGCGTGTGCACTTCAATCCAATATCATTAAAGAAGTTTATAATTTGAATCTGATGTCAAAAGA...

CDS

Download CDS FASTA

555 bp · LXL04_012990|LXL04_012990|OH1004|CDS

ATGTGGGACGCATTCAGCTCACCACCGTCTCTACTAATCCACAAAAAGCTTCGGATTTTCATTCAGATCTCCGATCAATCGCTTCCGGTTCTTCCTTCTTTTCTCTCCTCCTCATCCTCGTCGCCCTCATCTCCATCGCCACCGCCGAGATTCGTTTCATGGCTTCAGGTTCTCCAACAGATCGAAGACGGGGAGATAGCGTGTGCACTTCAATCCAATATCATTAAAGAAGTTTATAATTTGAATCTGATGTCAAAAGA...

Protein

Download Protein FASTA

184 aa · LXL04_012990|LXL04_012990|OH1004|PROTEIN

MWDAFSSPPSLLIHKKLRIFIQISDQSLPVLPSFLSSSSSSPSSPSPPPRFVSWLQVLQQIEDGEIACALQSNIIKEVYNLNLMSKDATGFNHYYLQSDADQYTLVFANCLPHLKVSMDVRSDMYKLDGKTNTRDYLSARITVLPRACDCRGISWTWGDYLHTCAIVDFTIDSILDFTIDLLCD

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_012990`
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_012990

Location Chr03:22006151-22006871 (-)

Description Similar to CAND7: Protein CANDIDATE G-PROTEIN COUPLED RECEPTOR 7

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At5g18520`	Plays a role in plants and microbes interactions.	Two G-protein-coupled-receptor candidates, Cand2 and Cand7, are involved in Arabidopsis root growth mediated by the bacterial quorum-sensing signals N-acyl-homoserine lactones.2012 · DOI: 10.1016/j.bbrc.2011.12.066

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_012990 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0002237 response to molecule of bacterial origin Biological Process

GO:0007186 G protein-coupled receptor signaling pathway Biological Process

GO:0010015 root morphogenesis Biological Process

GO:0072659 protein localization to plasma membrane Biological Process

GO:2001008 positive regulation of cellulose biosynthetic process Biological Process

GO:0005794 Golgi apparatus Cellular Component

GO:0005802 trans-Golgi network Cellular Component

GO:0009507 chloroplast Cellular Component

GO:0016020 membrane Cellular Component

GO:0004930 G protein-coupled receptor activity Molecular Function

KEGG gene cross-reference

ath:AT5G18520

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Endoplasmic reticulum0.311

Rank 1 · LXL04_012990 · OH-1004

Cytoplasm0.281

Rank 2 · LXL04_012990 · OH-1004

Nucleus0.273

Rank 3 · LXL04_012990 · OH-1004

Cell membrane0.125

Rank 4 · LXL04_012990 · OH-1004

Mitochondrion0.111

Rank 5 · LXL04_012990 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF21904.2CAND6-7_N53-125 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_012990	`PF21904.2`	CAND6-7_N	53	125	4.4e-14	53.5

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`F4JY11`	Arabidopsis thaliana	Protein CANDIDATE G PROTEIN-COUPLED RECEPTOR 7	38.298%	Swiss-Prot	moderate database homology

JBrowse

View in Genome Browser

Gene Card