Gene Card
Gene overview
cDNA / CDS / Protein Sequences
2619 bp · LXL04_012923|LXL04_012923|OH1004|cDNA
ATGGATCCATCGCTGAACGAAGAAGCCCAATCCCCAAAAATATCAGCGAAAGCAGAAGCTTTGAAACAGTTTTCTTCTTCTGTGAAACCCCCTTCTTTCTCCTCTTCAATATCAAAACTTTCCGGGTCTTCAAGAGGCATTCCATCCAATAAAGATTTCCACTTCTACTTCAACTTCGAAGAATTCAAGACCCCAATTCAGGAAATGGCCAAACACTCCCAATCAATTCTTGAAACAATTGGGTCGTCCGCCGAGCAATT...
2619 bp · LXL04_012923|LXL04_012923|OH1004|CDS
ATGGATCCATCGCTGAACGAAGAAGCCCAATCCCCAAAAATATCAGCGAAAGCAGAAGCTTTGAAACAGTTTTCTTCTTCTGTGAAACCCCCTTCTTTCTCCTCTTCAATATCAAAACTTTCCGGGTCTTCAAGAGGCATTCCATCCAATAAAGATTTCCACTTCTACTTCAACTTCGAAGAATTCAAGACCCCAATTCAGGAAATGGCCAAACACTCCCAATCAATTCTTGAAACAATTGGGTCGTCCGCCGAGCAATT...
Protein
Download Protein FASTA872 aa · LXL04_012923|LXL04_012923|OH1004|PROTEIN
MDPSLNEEAQSPKISAKAEALKQFSSSVKPPSFSSSISKLSGSSRGIPSNKDFHFYFNFEEFKTPIQEMAKHSQSILETIGSSAEQLWGKKQMKFPNGDIDDDDEAYDWLVNINDELFERFDSSLDEFKKIRNKEEETGVRVKNLVDDDGFQLVQGRKKKDSLVNNGNTSNSPDSNLGNASSVKVVSRDSNAKAKVSFHIPSIRRPQDEYKILVNNANQPFEHVWLQRSEDGSKLIHPLENLSIMDFIDKTVSDEEPVKP...
Flanking Sequence Download
Sequence orientation and download details
Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.
ID Mapping
| Input ID | LXL04_012923 |
|---|---|
| Source version | OH-1004 / GCA_047496595.1_OSU_TarKok_2.0 |
SNP / Indel variants and carrier samplesCRA009020 · OH-1004
Expand to load variant records for this gene.
Basic Information and Functional Annotation
| Gene ID | LXL04_012923 | |||||||||
|---|---|---|---|---|---|---|---|---|---|---|
| Location | Chr03:20902229-20906020 (-) | |||||||||
| Description | Similar to RRP6L2: Protein RRP6-like 2 | |||||||||
| Arabidopsis / Rice Reference Genes and Papers |
Download references for this gene Arabidopsis
RiceNo hit for this species in the current source table. | |||||||||
| Functional annotation source | View annotation sourcesFunctional annotation source: OH1004 · | |||||||||
| GO annotations (OH1004 source) | GO:0000184 nuclear-transcribed mRNA catabolic process, nonsense-mediated decay Biological Process GO:0000460 maturation of 5.8S rRNA Biological Process GO:0000467 exonucleolytic trimming to generate mature 3'-end of 5.8S rRNA from tricistronic rRNA transcript (SSU-rRNA, 5.8S rRNA, LSU-rRNA) Biological Process GO:0000956 nuclear-transcribed mRNA catabolic process Biological Process GO:0006281 DNA repair Biological Process GO:0006346 DNA methylation-dependent constitutive heterochromatin formation Biological Process GO:0006364 rRNA processing Biological Process GO:0006396 RNA processing Biological Process GO:0006401 RNA catabolic process Biological Process GO:0032211 negative regulation of telomere maintenance via telomerase Biological Process GO:0042274 ribosomal small subunit biogenesis Biological Process GO:0043633 polyadenylation-dependent RNA catabolic process Biological Process | |||||||||
| KEGG gene cross-reference | ath:AT1G54440 ath:AT5G35910 hsa:5394 mmu:50912 rno:313707 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene. |
Gene expression
View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.
Data sources and gene correspondence
Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.
Subcellular Localization Top 5
Computational predictions or homology annotations below do not replace localization experiments.
LocPro · Direct prediction · Computational prediction, not experimental localization
Predicted Functional Domains
Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.
PF08066.18PMC2NT43-130 aaPF01612.27DNA_pol_A_exo1269-436 aaPF00570.29HRDC490-553 aa| Gene ID | Domain ID | Domain Name | Start aa | End aa | E-value | Score |
|---|---|---|---|---|---|---|
| LXL04_012923 | PF08066.18 | PMC2NT | 43 | 130 | 1.6e-09 | 38.9 |
| LXL04_012923 | PF01612.27 | DNA_pol_A_exo1 | 269 | 436 | 3.4e-47 | 161.2 |
| LXL04_012923 | PF00570.29 | HRDC | 490 | 553 | 4.6e-12 | 46.4 |
Arabidopsis / Rice Protein Homology
Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.