LXL04_012766 | RubberDandelionOmics

Gene overview

LXL04_012766

Reference: OH-1004 Chr: Chr03 Coordinates: 18402239-18404288 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

846 bp · LXL04_012766|LXL04_012766|OH1004|cDNA

ATGGAAAGCCAACCTAATTTTTTTCCTTGCAACAATCGGCCGCTCCATCTATTTCACCCTCGATCAAGCAAAAACGGCCCCCGCTCCACTACCTTCGCTCCACCACCTCCGCCACCTGCTGCTCTCGTCACCCAAAATCGATTCTCGCTACTGTCGCTGCTCGATCAGACTCGTGTTTCGTCTCCCTATTCGTCTCTCTTCACGAACACCATTTCACCACTGAAGCTCTATTATTTGTTGTTGTACCAATTCTCCCTCCC...

CDS

Download CDS FASTA

846 bp · LXL04_012766|LXL04_012766|OH1004|CDS

ATGGAAAGCCAACCTAATTTTTTTCCTTGCAACAATCGGCCGCTCCATCTATTTCACCCTCGATCAAGCAAAAACGGCCCCCGCTCCACTACCTTCGCTCCACCACCTCCGCCACCTGCTGCTCTCGTCACCCAAAATCGATTCTCGCTACTGTCGCTGCTCGATCAGACTCGTGTTTCGTCTCCCTATTCGTCTCTCTTCACGAACACCATTTCACCACTGAAGCTCTATTATTTGTTGTTGTACCAATTCTCCCTCCC...

Protein

Download Protein FASTA

281 aa · LXL04_012766|LXL04_012766|OH1004|PROTEIN

MESQPNFFPCNNRPLHLFHPRSSKNGPRSTTFAPPPPPPAALVTQNRFSLLSLLDQTRVSSPYSSLFTNTISPLKLYYLLLYQFSLPLFPDAPIRKFTIAVHRAPANVNDSRTHTTNWYIVGERSSSLPTSGLRIAPYSNINPNIPITLRTVIPPPPPPPPVTPFVSLQTPGRSRSRSPLPVSYSLAQRHSPQDHRVGIDLPTIEVKFEHLTVEADVNTGSRAIPVSLTSTLISWRGVHSHIIRSVSHDLRTGTLRTQSQ...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_012766`
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_012766

Location Chr03:18402239-18404288 (-)

Description Similar to ABCG43: ABC transporter G family member 43

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At1g15520`	May participate in transmembrane ABA import and associated signaling.	PDR-type ABC transporter mediates cellular uptake of the phytohormone abscisic acid.2010 · DOI: 10.1073/pnas.0909222107 ABA transport factors found in Arabidopsis ABC transporters.2010 · DOI: 10.4161/psb.5.9.12566 Arabidopsis Lectin Receptor Kinases LecRK-IX.1 and LecRK-IX.2 Are Functional Analogs in Regulating Phytophthora Resistance and Plant Cell Death.2015 · DOI: 10.1094/mpmi-02-15-0025-r Abscisic acid transporters cooperate to control seed germination.2015 · DOI: 10.1038/ncomms9113

Rice

Reference gene ID	Possible function	Papers / DOI
`Os07g0522500`	ABC transporter modulating cadmium (Cd) import, thus controlling Cd²⁺ accumulation to prevent phytotoxicity.	Rice ABCG43 is Cd inducible and confers Cd tolerance on yeast.2011 · DOI: 10.1271/bbb.110193 Cadmium accumulation regulated by a rice heavy-metal importer is harmful for host plant and leaf bacteria.2023 · DOI: 10.1016/j.jare.2022.05.010
`Os01g0609900`	May be a general defense protein.	No verified direct reference in this release

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_012766 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0002229 defense response to oomycetes Biological Process

GO:0009408 response to heat Biological Process

GO:0009409 response to cold Biological Process

GO:0009414 response to water deprivation Biological Process

GO:0009617 response to bacterium Biological Process

GO:0009723 response to ethylene Biological Process

GO:0009737 response to abscisic acid Biological Process

GO:0009738 abscisic acid-activated signaling pathway Biological Process

GO:0009751 response to salicylic acid Biological Process

GO:0009753 response to jasmonic acid Biological Process

GO:0009914 hormone transport Biological Process

GO:0010193 response to ozone Biological Process

KEGG gene cross-reference

ath:AT1G15520

dosa:Os01g0609900

dosa:Os07g0522500

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.487

Rank 1 · LXL04_012766 · OH-1004

Cytoplasm0.432

Rank 2 · LXL04_012766 · OH-1004

Mitochondrion0.100

Rank 3 · LXL04_012766 · OH-1004

Cell membrane0.051

Rank 4 · LXL04_012766 · OH-1004

Endoplasmic reticulum0.047

Rank 5 · LXL04_012766 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

No result was found for this query.

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9M9E1`	Arabidopsis thaliana	ABC transporter G family member 40	73.333%	Swiss-Prot	weak database homology
`Q8GU86`	Oryza sativa subsp. japonica	ABC transporter G family member 43	35.802%	Swiss-Prot	weak database homology
`Q8GU89`	Oryza sativa subsp. japonica	ABC transporter G family member 37	39.286%	Swiss-Prot	weak database homology

JBrowse

View in Genome Browser

Gene Card