LXL04_012741 | RubberDandelionOmics

Gene overview

LXL04_012741

Reference: OH-1004 Chr: Chr03 Coordinates: 18055733-18057478 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1008 bp · LXL04_012741|LXL04_012741|OH1004|cDNA

ATGAGGCGAGCTTCTAGTCTCGCTGCTTCCTCAGCCCTATCCCGAGTCCTTCTAGCATCATCAGAACAACAACACACAAGGCTCTTCCAGGTCACATCCTTTTACGGCGGCCTCAATGCTGGTTCTCCCCGGCGGTCGTTTTCAACATCCATGAGATCCATATCTCGAGGCGTCTACTCCGGTACTGCTAAATATTTTATGTCCTTGGGTGGTGTTGTTGCCGCGTCCGTCGCTGCTGGTGCCTCATCATTGTTGGTGGA...

CDS

Download CDS FASTA

1008 bp · LXL04_012741|LXL04_012741|OH1004|CDS

ATGAGGCGAGCTTCTAGTCTCGCTGCTTCCTCAGCCCTATCCCGAGTCCTTCTAGCATCATCAGAACAACAACACACAAGGCTCTTCCAGGTCACATCCTTTTACGGCGGCCTCAATGCTGGTTCTCCCCGGCGGTCGTTTTCAACATCCATGAGATCCATATCTCGAGGCGTCTACTCCGGTACTGCTAAATATTTTATGTCCTTGGGTGGTGTTGTTGCCGCGTCCGTCGCTGCTGGTGCCTCATCATTGTTGGTGGA...

Protein

Download Protein FASTA

335 aa · LXL04_012741|LXL04_012741|OH1004|PROTEIN

MRRASSLAASSALSRVLLASSEQQHTRLFQVTSFYGGLNAGSPRRSFSTSMRSISRGVYSGTAKYFMSLGGVVAASVAAGASSLLVEEEAYAKELLKPDLVPKDVVLYQYEACPFCNKVKAFLDYYDVPYKVVEVNPWSKNEIKWSEYKKVPILTVDGEPLVDSSAIINQMGNRIIPGRSSSTGKTNDEEKKWCRWVDDHLVHMLSPNIYRNTSEALESFDYIANNGNFSFSEKYAVKYAGAAAMYFVSKKLKKKYNITD...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_012741`
TK1151 ID	TkA02G540620
OH-1004 ID	LXL04_012741
Relationship / confidence	Rbh High Identity Coverage Synteny / Strict
Protein identity (%)	100.000
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID	`LXL04_012741`
Location	Chr03:18055733-18057478 (-)
Description	Similar to PTGES2: Prostaglandin E synthase 2
Arabidopsis / Rice Reference Genes and Papers	Download references for this gene Arabidopsis No hit for this species in the current source table. Rice No hit for this species in the current source table.
Functional annotation source	View annotation sources Functional annotation source: OH1004 · `LXL04_012741` · GCA_047496595.1_OSU_TarKok_2.0.
GO annotations (OH1004 source)	GO:0006629 lipid metabolic process Biological Process GO:0045893 positive regulation of DNA-templated transcription Biological Process GO:0046457 prostanoid biosynthetic process Biological Process GO:0046903 secretion Biological Process GO:0000139 Golgi membrane Cellular Component GO:0005576 extracellular region Cellular Component GO:0005634 nucleus Cellular Component GO:0005739 mitochondrion Cellular Component GO:0005829 cytosol Cellular Component GO:0035578 azurophil granule lumen Cellular Component GO:0048471 perinuclear region of cytoplasm Cellular Component GO:0003677 DNA binding Molecular Function
KEGG gene cross-reference	bta:493639 dre:799964 hsa:80142 mmu:96979 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Mitochondrion0.949

Rank 1 · LXL04_012741 · OH-1004

Cytoplasm0.069

Rank 2 · LXL04_012741 · OH-1004

Nucleus0.057

Rank 3 · LXL04_012741 · OH-1004

Cell membrane0.031

Rank 4 · LXL04_012741 · OH-1004

Plastid0.018

Rank 5 · LXL04_012741 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00462.31Glutaredoxin105-159 aa

PF02798.27GST_N105-168 aa

PF13417.13GST_N_3107-169 aa

PF13409.13GST_N_2112-168 aa

PF17172.11GST_N_4114-205 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_012741	`PF00462.31`	Glutaredoxin	105	159	3.2e-10	40.8
LXL04_012741	`PF02798.27`	GST_N	105	168	5.7e-06	27.3
LXL04_012741	`PF13417.13`	GST_N_3	107	169	4.5e-13	50.0
LXL04_012741	`PF13409.13`	GST_N_2	112	168	2.5e-09	38.3
LXL04_012741	`PF17172.11`	GST_N_4	114	205	1.4e-07	32.8

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

No result was found for this query.

JBrowse

View in Genome Browser

Gene Card