LXL04_012711 | RubberDandelionOmics

Gene overview

LXL04_012711

Reference: OH-1004 Chr: Chr03 Coordinates: 17492998-17495021 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1244 bp · LXL04_012711|LXL04_012711|OH1004|cDNA

CATCCATCCATCATCACATACATACAACATACGTATACGACACATACATGCATCccAACACCCTCTTTCCTTCTCCCTATAAATCCCCCCCTTTGCCTCCAATTCCAATCTTCAAACCGATTCCCAAATTTCCAATTCAACCCTTTTGTCCAATTCAATGGGTGAGGTTAAAAGATGATACAAAGAAGGAAGCTGGTGAGAAGAAGCCCGCCAATGCTGGCGGCGCAAAAAAGGCCGACGGTGGCCCTGTTACCGTAGTT...

CDS

Download CDS FASTA

1197 bp · LXL04_012711|LXL04_012711|OH1004|CDS

ATGCATCCCAACACCCTCTTTCCTTCTCCCTATAAATCCCCCCCTTTGCCTCCAATTCCAATCTTCAAACCGATTCCCAAATTTCCAATTCAACCCTTTTGTCCAATTCAATGGGTGAGGTTAAAAGATGATACAAAGAAGGAAGCTGGTGAGAAGAAGCCCGCCAATGCTGGCGGCGCAAAAAAGGCCGACGGTGGCCCTGTTACCGTAGTTCTTAAAATCGAGATGCATTGCGATGGATGCGCCAAGAAAATCTCAAA...

Protein

Download Protein FASTA

398 aa · LXL04_012711|LXL04_012711|OH1004|PROTEIN

MHPNTLFPSPYKSPPLPPIPIFKPIPKFPIQPFCPIQWVRLKDDTKKEAGEKKPANAGGAKKADGGPVTVVLKIEMHCDGCAKKISKSIRHFEGVESVKADTAGNKLTVTGKVDPTRIKERLEYKTKKKVEILSPQPKKDGGGGGGEKKSDEKEKEKLPEKKTVDEKKPKEPQSSTVVLKIPLHCDGCIHKIKRQISKIDGVEAVMPDSGKDLVTVKGTMNVKELLPHLKEKLKRKIDIVPPKKDEKGGDSKDDKKEKGG...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_012711`
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_012711

Location Chr03:17492998-17495021 (-)

Description Similar to HIPP05: Heavy metal-associated isoprenylated plant protein 5

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At2g36950`	Heavy-metal-binding protein (By similarity).	No verified direct reference in this release
`At5g03380`	Heavy-metal-binding protein.	Functional characterization of a heavy metal binding protein CdI19 from Arabidopsis.2002 · DOI: 10.1046/j.1365-313x.2002.01412.x
`At5g60800`	Heavy-metal-binding protein.	The zinc-binding nuclear protein HIPP3 acts as an upstream regulator of the salicylate-dependent plant immunity pathway and of flowering time in Arabidopsis thaliana.2015 · DOI: 10.1111/nph.13419
`At3g02960`	Heavy-metal-binding protein.	No verified direct reference in this release
`At2g28090`	Heavy-metal-binding protein.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_012711 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0009910 negative regulation of flower development Biological Process

GO:0071456 cellular response to hypoxia Biological Process

GO:0005634 nucleus Cellular Component

GO:0005730 nucleolus Cellular Component

GO:0005737 cytoplasm Cellular Component

GO:0005886 plasma membrane Cellular Component

GO:0005507 copper ion binding Molecular Function

GO:0008270 zinc ion binding Molecular Function

GO:0046872 metal ion binding Molecular Function

KEGG gene cross-reference

ath:AT2G36950

ath:AT5G03380

ath:AT5G60800

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.442

Rank 1 · LXL04_012711 · OH-1004

Cell membrane0.428

Rank 2 · LXL04_012711 · OH-1004

Nucleus0.320

Rank 3 · LXL04_012711 · OH-1004

Endoplasmic reticulum0.053

Rank 4 · LXL04_012711 · OH-1004

Golgi apparatus0.027

Rank 5 · LXL04_012711 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00403.33HMA72-123 aa

PF00403.33HMA179-236 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_012711	`PF00403.33`	HMA	72	123	3.7e-25	88.8
LXL04_012711	`PF00403.33`	HMA	179	236	3.7e-25	88.8

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9SJL2`	Arabidopsis thaliana	Heavy metal-associated isoprenylated plant protein 5	43.626%	Swiss-Prot	moderate database homology
`Q9LZF1`	Arabidopsis thaliana	Heavy metal-associated isoprenylated plant protein 6	40.201%	Swiss-Prot	moderate database homology
`Q9FJH5`	Arabidopsis thaliana	Heavy metal-associated isoprenylated plant protein 3	51.124%	Swiss-Prot	weak database homology
`Q9M8T7`	Arabidopsis thaliana	Heavy metal-associated isoprenylated plant protein 8	35.465%	Swiss-Prot	weak database homology
`Q9ZUV1`	Arabidopsis thaliana	Heavy metal-associated isoprenylated plant protein 1	44.068%	Swiss-Prot	weak database homology

JBrowse

View in Genome Browser

Gene Card