RubberDandelionOmics Rubber Dandelion Multi-omics Website
More
Transcriptome Expression Annotation Rubber Pathway TF Prediction Targets Protein Network Resequencing Tools Downloads
ZH EN

How to use this page

Gene Card

Enter a TK1151 or OH-1004 gene ID to view sequences, annotations and analyses in the corresponding reference genome.
Flanking length, max 10000 bp
Examples TkA01G624900 LXL04_000258

Gene overview

LXL04_012676
Reference: OH-1004 Chr: Chr03 Coordinates: 16734866-16738667 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

Download cDNA FASTA

3045 bp · LXL04_012676|LXL04_012676|OH1004|cDNA

ATGGGAGATGATATCGTACGTGAGCTTCGCAACGGGAATCCTTCTATGCCTTTGTTAATTCCAGAGACAATGGTACGAGAACAGATTTTGGTCGAATTGGAGAAAATGCTAAATGAAGCAACTCCGTCTAAGTCATTATCAGATTTTCGTTTGCCAACCCCATCTCCGGCGAATTTGCGGGTTTTAAGGAACAGGCTTTTGCTTGAAGAAAGGTCTTATGATACAGCATTTTTATCAACTGAACTTGCTAGAATGAAAGC...

CDS

Download CDS FASTA

3045 bp · LXL04_012676|LXL04_012676|OH1004|CDS

ATGGGAGATGATATCGTACGTGAGCTTCGCAACGGGAATCCTTCTATGCCTTTGTTAATTCCAGAGACAATGGTACGAGAACAGATTTTGGTCGAATTGGAGAAAATGCTAAATGAAGCAACTCCGTCTAAGTCATTATCAGATTTTCGTTTGCCAACCCCATCTCCGGCGAATTTGCGGGTTTTAAGGAACAGGCTTTTGCTTGAAGAAAGGTCTTATGATACAGCATTTTTATCAACTGAACTTGCTAGAATGAAAGC...

Protein

Download Protein FASTA

1014 aa · LXL04_012676|LXL04_012676|OH1004|PROTEIN

MGDDIVRELRNGNPSMPLLIPETMVREQILVELEKMLNEATPSKSLSDFRLPTPSPANLRVLRNRLLLEERSYDTAFLSTELARMKAQLNAEQLNIYNEVCKHAENKKQLLIFVYGHGGTGKTFLWTTILAYFRSTSKVVLAVAASATMSDRRCFECVDRSFRDILGKRFLPFGGMTMLLGGDFQQTLPVKPKKKPSEIIDSTLPKSCLWRFFTVYSLTYNVRVSRADVSPSEQQRIHAFTTWLLNIGDGTIGPTDPSAP...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

Download Gene (CDS) Download Protein

ID Mapping

Input IDLXL04_012676
Source versionOH-1004 / GCA_047496595.1_OSU_TarKok_2.0
Open Full ID Mapping
SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene IDLXL04_012676
LocationChr03:16734866-16738667 (+)
DescriptionSimilar to pif1: ATP-dependent DNA helicase PIF1
Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

No hit for this species in the current source table.

Rice

No hit for this species in the current source table.

Functional annotation source
View annotation sources

Functional annotation source: OH1004 · LXL04_012676 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)
GO:0000723 telomere maintenance Biological Process
GO:0001117 protein-DNA-RNA complex disassembly Biological Process
GO:0006281 DNA repair Biological Process
GO:0006310 DNA recombination Biological Process
GO:0007004 telomere maintenance via telomerase Biological Process
GO:0032211 negative regulation of telomere maintenance via telomerase Biological Process
GO:0000781 chromosome, telomeric region Cellular Component
GO:0005634 nucleus Cellular Component
GO:0005654 nucleoplasm Cellular Component
GO:0005739 mitochondrion Cellular Component
GO:0042645 mitochondrial nucleoid Cellular Component
GO:0000287 magnesium ion binding Molecular Function
KEGG gene cross-reference
hsa:80119
mmu:208084
rno:367645
xla:734585
These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.
Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene
Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.757
Rank 1 · LXL04_012676 · OH-1004
Cytoplasm0.290
Rank 2 · LXL04_012676 · OH-1004
Mitochondrion0.038
Rank 3 · LXL04_012676 · OH-1004
Cell membrane0.022
Rank 4 · LXL04_012676 · OH-1004
Endoplasmic reticulum0.018
Rank 5 · LXL04_012676 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF05970.21PIF188-146 aa
PF05970.21PIF1147-253 aa
PF21530.4Pif1_2B_dom356-402 aa
PF02689.21Herpes_Helicase444-496 aa
Gene IDDomain IDDomain NameStart aaEnd aaE-valueScore
LXL04_012676PF05970.21PIF1881461.1e-44153.4
LXL04_012676PF05970.21PIF11472531.1e-44153.4
LXL04_012676PF21530.4Pif1_2B_dom3564027.7e-1658.3
LXL04_012676PF02689.21Herpes_Helicase4444964.2e-0625.8

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

No result was found for this query.

JBrowse

View in Genome Browser