LXL04_012646 | RubberDandelionOmics

Gene overview

LXL04_012646

Reference: OH-1004 Chr: Chr03 Coordinates: 16226513-16227681 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

861 bp · LXL04_012646|LXL04_012646|OH1004|cDNA

ATGGCGGCCCTCTCCCGCCTCTTCAAACCCCAATTTTCATCTCTATTTCAGCGATCGCTTTCCACCACCACTGTCTCCGTTTCCGAAATCCAGCCTCAACGTGACAAATCTTCCAAACCTCTACCGCCGATCACAGATGATCCTCAGGGTTCTAGGAATTTCCAGTGGGTGTTTTTAGGCTGTCCCGGCGTCGGAAAGGGAACATATGCCAGTCGACTCTCCGCTCTTCTCGGTGTCCCTCACATCGCCACCGGTGATCT...

CDS

Download CDS FASTA

861 bp · LXL04_012646|LXL04_012646|OH1004|CDS

ATGGCGGCCCTCTCCCGCCTCTTCAAACCCCAATTTTCATCTCTATTTCAGCGATCGCTTTCCACCACCACTGTCTCCGTTTCCGAAATCCAGCCTCAACGTGACAAATCTTCCAAACCTCTACCGCCGATCACAGATGATCCTCAGGGTTCTAGGAATTTCCAGTGGGTGTTTTTAGGCTGTCCCGGCGTCGGAAAGGGAACATATGCCAGTCGACTCTCCGCTCTTCTCGGTGTCCCTCACATCGCCACCGGTGATCT...

Protein

Download Protein FASTA

286 aa · LXL04_012646|LXL04_012646|OH1004|PROTEIN

MAALSRLFKPQFSSLFQRSLSTTTVSVSEIQPQRDKSSKPLPPITDDPQGSRNFQWVFLGCPGVGKGTYASRLSALLGVPHIATGDLVRDELSSSGPLSHQLEEVVNQGKLVSDEIIFNLLSKRLEAGESKGESGFILDGFPRTIRQAEILDEVTEIDLVVNLKLREDVLIEKCLGRRICSECGKGFNLASINAKAENGDPEITMAPLLPPPQCSSKLITRADDTEPVVRKRLRVYKEQSEPVEDYYRKQGKLTEFNLPG...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_012646`
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_012646

Location Chr03:16226513-16227681 (-)

Description Similar to ADK: Adenylate kinase 1, chloroplastic

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At2g37250`	Catalyzes the reversible transfer of the terminal phosphate group between ATP and AMP.	Deficiency of a plastidial adenylate kinase in Arabidopsis results in elevated photosynthetic amino acid biosynthesis and enhanced growth.2005 · DOI: 10.1104/pp.104.056143
`At2g39270`	Catalyzes the reversible transfer of the terminal phosphate group between ATP and AMP.	No verified direct reference in this release

Rice

Reference gene ID	Possible function	Papers / DOI
`Os03g0130400`	Catalyzes the reversible transfer of the terminal phosphate group between ATP and AMP.	No verified direct reference in this release
`Os04g0671100`	Catalyzes the reversible transfer of the terminal phosphate group between ATP and AMP.	No verified direct reference in this release

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_012646 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0008652 amino acid biosynthetic process Biological Process

GO:0048364 root development Biological Process

GO:0048367 shoot system development Biological Process

GO:0005634 nucleus Cellular Component

GO:0005737 cytoplasm Cellular Component

GO:0005739 mitochondrion Cellular Component

GO:0009507 chloroplast Cellular Component

GO:0009570 chloroplast stroma Cellular Component

GO:0004017 AMP kinase activity Molecular Function

GO:0005524 ATP binding Molecular Function

KEGG gene cross-reference

ath:AT2G37250

ath:AT2G39270

dosa:Os03g0130400

dosa:Os04g0671100

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Mitochondrion0.741

Rank 1 · LXL04_012646 · OH-1004

Plastid0.284

Rank 2 · LXL04_012646 · OH-1004

Cytoplasm0.061

Rank 3 · LXL04_012646 · OH-1004

Nucleus0.047

Rank 4 · LXL04_012646 · OH-1004

Cell membrane0.013

Rank 5 · LXL04_012646 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00406.30ADK59-251 aa

PF13207.13AAA_1759-178 aa

PF13238.13AAA_1859-178 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_012646	`PF00406.30`	ADK	59	251	3.1e-40	138.5
LXL04_012646	`PF13207.13`	AAA_17	59	178	1.7e-20	74.4
LXL04_012646	`PF13238.13`	AAA_18	59	178	1.6e-06	29.4

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9ZUU1`	Arabidopsis thaliana	Adenylate kinase 1, chloroplastic	77.447%	Swiss-Prot	strong database homology
`Q84JF7`	Arabidopsis thaliana	Probable adenylate kinase 6, chloroplastic	65.649%	Swiss-Prot	strong database homology
`Q10S93`	Oryza sativa subsp. japonica	Probable adenylate kinase 1, chloroplastic	77.447%	Swiss-Prot	strong database homology
`Q7XR47`	Oryza sativa subsp. japonica	Probable adenylate kinase 6, chloroplastic	63.986%	Swiss-Prot	strong database homology

JBrowse

View in Genome Browser

Gene Card