LXL04_012639 | RubberDandelionOmics

Gene overview

LXL04_012639

Reference: OH-1004 Chr: Chr03 Coordinates: 16148794-16149886 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

243 bp · LXL04_012639|LXL04_012639|OH1004|cDNA

ATGGGTATTTATGCAGGGCTGGCGAAAATGGGCGAAAAGGAATGGTATTTTTTCTGTGTGAGGGATAAGAAGTATCCCACCGGATTGCGGACGAACAGAGCAACTGACGCAGGTTACTGGAAAGCCACCGGAAAAGATAAGGAGATTTTTCGGGGGAAATTGCTCGTCGGAATGAAGAAAACTCTGGTTTTCTATAAAGGGATAGCTCCAAAACGGGGAAAAAACAAATTGGGTAATTCATGA

CDS

Download CDS FASTA

243 bp · LXL04_012639|LXL04_012639|OH1004|CDS

ATGGGTATTTATGCAGGGCTGGCGAAAATGGGCGAAAAGGAATGGTATTTTTTCTGTGTGAGGGATAAGAAGTATCCCACCGGATTGCGGACGAACAGAGCAACTGACGCAGGTTACTGGAAAGCCACCGGAAAAGATAAGGAGATTTTTCGGGGGAAATTGCTCGTCGGAATGAAGAAAACTCTGGTTTTCTATAAAGGGATAGCTCCAAAACGGGGAAAAAACAAATTGGGTAATTCATGA

Protein

Download Protein FASTA

80 aa · LXL04_012639|LXL04_012639|OH1004|PROTEIN

MGIYAGLAKMGEKEWYFFCVRDKKYPTGLRTNRATDAGYWKATGKDKEIFRGKLLVGMKKTLVFYKGIAPKRGKNKLGNS

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_012639`
TK1151 ID	TkA02G547670
OH-1004 ID	LXL04_012639
Relationship / confidence	Rbh Below Probable Coverage Or Synteny Threshold / Review
Protein identity (%)	98.500
Protein coverage (%)	TK1151 62.963 / OH-1004 85.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_012639

Location Chr03:16148794-16149886 (-)

Description Similar to NAC100: NAC domain-containing protein 100

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At5g61430`	Binds to the promoter regions of genes involved in chlorophyll catabolic processes, such as NYC1, SGR1, SGR2 and PAO.	No verified direct reference in this release
`At5g07680`	NAC domain-containing protein 79.	No verified direct reference in this release
`At5g39610`	Transcription activator that binds to DNA in promoters of target genes on a specific bipartite motif 5'-[ACG][CA]GT[AG](5-6n)[CT]AC[AG]-3'.	The delayed leaf senescence mutants of Arabidopsis, ore1, ore3, and ore9 are tolerant to oxidative stress.2004 · DOI: 10.1093/pcp/pch110 Trifurcate feed-forward regulation of age-dependent cell death involving miR164 in Arabidopsis.2009 · DOI: 10.1126/science.1166386 Forward and reverse genetics to identify genes involved in the age-related resistance response in Arabidopsis thaliana.2009 · DOI: 10.1111/j.1364-3703.2009.00557.x A gene regulatory network controlled by the NAC transcription factor ANAC092/AtNAC2/ORE1 during salt-promoted senescence.2010 · DOI: 10.1111/j.1365-313x.2010.04151.x ORS1, an H₂O₂-responsive NAC transcription factor, controls senescence in Arabidopsis thaliana.2011 · DOI: 10.1093/mp/ssq080 NAC transcription factor ORE1 and senescence-induced BIFUNCTIONAL NUCLEASE1 (BFN1) constitute a regulatory cascade in Arabidopsis.2013 · DOI: 10.1093/mp/sst012 ORE1 balances leaf senescence against maintenance by antagonizing G2-like-mediated transcription.2013 · DOI: 10.1038/embor.2013.24
`At3g29035`	Transcription activator that binds to DNA in promoters of target genes on a specific bipartite motif 5'-[AG]CGT[AG](4- 5n)[AG][CT]ACGCAA-3'.	ORS1, an H₂O₂-responsive NAC transcription factor, controls senescence in Arabidopsis thaliana.2011 · DOI: 10.1093/mp/ssq080

Rice

Reference gene ID	Possible function	Papers / DOI
`Os04g0460600`	Transcription factor involved in the regulation of tiller bud outgrowth, but does not seem to regulate tiller bud initiation.	Overexpression of a NAC-domain protein promotes shoot branching in rice.2007 · DOI: 10.1111/j.1469-8137.2007.02177.x OsNAC2 encoding a NAC transcription factor that affects plant height through mediating the gibberellic acid pathway in rice.2015 · DOI: 10.1111/tpj.12819 A Rice NAC Transcription Factor Promotes Leaf Senescence via ABA Biosynthesis.2017 · DOI: 10.1104/pp.17.00542 Overexpression of miR164b-resistant OsNAC2 improves plant architecture and grain yield in rice.2018 · DOI: 10.1093/jxb/ery017 OsNAC2 positively affects salt-induced cell death and binds to the OsAP37 and OsCOX11 promoters.2018 · DOI: 10.1111/tpj.13867 OsNAC2 integrates auxin and cytokinin pathways to modulate rice root development.2020 · DOI: 10.1111/pbi.13209 Overexpression of a microRNA-targeted NAC transcription factor improves drought and salt tolerance in Rice via ABA-mediated pathways.2019 · DOI: 10.1186/s12284-019-0334-6 OsNAC2 Is Involved in Multiple Hormonal Pathways to Mediate Germination of Rice Seeds and Establishment of Seedling.2021 · DOI: 10.3389/fpls.2021.699303

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_012639 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0006351 DNA-templated transcription Biological Process

GO:0006355 regulation of DNA-templated transcription Biological Process

GO:0006979 response to oxidative stress Biological Process

GO:0009611 response to wounding Biological Process

GO:0009651 response to salt stress Biological Process

GO:0009723 response to ethylene Biological Process

GO:0009733 response to auxin Biological Process

GO:0009734 auxin-activated signaling pathway Biological Process

GO:0009737 response to abscisic acid Biological Process

GO:0009738 abscisic acid-activated signaling pathway Biological Process

GO:0009740 gibberellic acid mediated signaling pathway Biological Process

GO:0009873 ethylene-activated signaling pathway Biological Process

KEGG gene cross-reference

ath:AT3G29035

ath:AT5G07680

ath:AT5G39610

ath:AT5G61430

dosa:Os04g0460600

osa:4336052

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.928

Rank 1 · LXL04_012639 · OH-1004

Cytoplasm0.083

Rank 2 · LXL04_012639 · OH-1004

Extracellular0.035

Rank 3 · LXL04_012639 · OH-1004

Endoplasmic reticulum0.028

Rank 4 · LXL04_012639 · OH-1004

Cell membrane0.024

Rank 5 · LXL04_012639 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF02365.21NAM8-68 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_012639	`PF02365.21`	NAM	8	68	1.1e-20	75.0

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9FLJ2`	Arabidopsis thaliana	NAC domain-containing protein 100	86.765%	Swiss-Prot	strong database homology
`Q9FLR3`	Arabidopsis thaliana	NAC domain-containing protein 79	88.060%	Swiss-Prot	strong database homology
`Q9FKA0`	Arabidopsis thaliana	NAC domain-containing protein 92	92.188%	Swiss-Prot	strong database homology
`Q9LJW3`	Arabidopsis thaliana	NAC domain-containing protein 59	90.625%	Swiss-Prot	strong database homology
`Q7XUV6`	Oryza sativa subsp. japonica	NAC domain-containing protein 4	81.159%	Swiss-Prot	strong database homology

JBrowse

View in Genome Browser

Gene Card