LXL04_012599 | RubberDandelionOmics

Gene overview

LXL04_012599

Reference: OH-1004 Chr: Chr03 Coordinates: 15320981-15321571 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

591 bp · LXL04_012599|LXL04_012599|OH1004|cDNA

ATGAGGACACAACTCTTCATTTTCATCGTCTTCTCCACGCTCGCGCTCTCTTCTGCCCAACCTCCGGTTCGTGACACAGACCGGAATATTCTCCGATCCGGCTCCGGCTACTACATCCTGCCTGCCACACGTGGCACAGGTGGCGGCATAAAACTATCCCCCAAAACCATAAACGAGACATGCCCCAGTGACGTGGTGCAAGAAAACAACGAGCTTTTAAACGGGCTACCGTTGACTTTTATACCGGTCACTGCTAACAA...

CDS

Download CDS FASTA

591 bp · LXL04_012599|LXL04_012599|OH1004|CDS

ATGAGGACACAACTCTTCATTTTCATCGTCTTCTCCACGCTCGCGCTCTCTTCTGCCCAACCTCCGGTTCGTGACACAGACCGGAATATTCTCCGATCCGGCTCCGGCTACTACATCCTGCCTGCCACACGTGGCACAGGTGGCGGCATAAAACTATCCCCCAAAACCATAAACGAGACATGCCCCAGTGACGTGGTGCAAGAAAACAACGAGCTTTTAAACGGGCTACCGTTGACTTTTATACCGGTCACTGCTAACAA...

Protein

Download Protein FASTA

196 aa · LXL04_012599|LXL04_012599|OH1004|PROTEIN

MRTQLFIFIVFSTLALSSAQPPVRDTDRNILRSGSGYYILPATRGTGGGIKLSPKTINETCPSDVVQENNELLNGLPLTFIPVTANKDGAITESTDLNIRFSGSSDCVQSAIWRVEAVNGVREISSHGRLGNPGVQTLSNWFKIEKYEDSYKLVFCPSVCNTCRPACADIGSTIAKSGRRSLVLNNVSLKVTFKKA

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_012599`
TK1151 ID	TkA02G550990
OH-1004 ID	LXL04_012599
Relationship / confidence	Rbh Below Probable Coverage Or Synteny Threshold / Review
Protein identity (%)	80.200
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_012599

Location Chr03:15320981-15321571 (-)

Description Similar to KTI5: Kunitz trypsin inhibitor 5

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At1g17860`	Can inhibit both serine proteases and cysteine proteases.	Arabidopsis Kunitz Trypsin Inhibitors in Defense Against Spider Mites.2018 · DOI: 10.3389/fpls.2018.00986
`At1g73260`	Exhibits Kunitz trypsin protease inhibitor activity.	Kunitz trypsin inhibitor: an antagonist of cell death triggered by phytopathogens and fumonisin b1 in Arabidopsis.2008 · DOI: 10.1093/mp/ssn013 Arabidopsis Kunitz Trypsin Inhibitors in Defense Against Spider Mites.2018 · DOI: 10.3389/fpls.2018.00986

Rice

Reference gene ID	Possible function	Papers / DOI
`Os04g0526600`	This protein inhibits independently subtilisin and T.castaneum alpha-amylase but not barley alpha-amylase.	No verified direct reference in this release

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_012599 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0002237 response to molecule of bacterial origin Biological Process

GO:0002238 response to molecule of fungal origin Biological Process

GO:0006952 defense response Biological Process

GO:0009611 response to wounding Biological Process

GO:0009624 response to nematode Biological Process

GO:0009625 response to insect Biological Process

GO:0009751 response to salicylic acid Biological Process

GO:0010466 negative regulation of peptidase activity Biological Process

GO:0012501 programmed cell death Biological Process

GO:0042542 response to hydrogen peroxide Biological Process

GO:0042742 defense response to bacterium Biological Process

GO:0005576 extracellular region Cellular Component

KEGG gene cross-reference

ath:AT1G17860

ath:AT1G73260

dosa:Os04g0526600

tcc:18604292

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Extracellular0.550

Rank 1 · LXL04_012599 · OH-1004

Cytoplasm0.145

Rank 2 · LXL04_012599 · OH-1004

Endoplasmic reticulum0.144

Rank 3 · LXL04_012599 · OH-1004

Lysosome / Vacuole0.086

Rank 4 · LXL04_012599 · OH-1004

Cell membrane0.066

Rank 5 · LXL04_012599 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00197.25Kunitz_legume23-195 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_012599	`PF00197.25`	Kunitz_legume	23	195	1.7e-50	172.1

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9LMU2`	Arabidopsis thaliana	Kunitz trypsin inhibitor 5	40.488%	Swiss-Prot	moderate database homology
`Q8RXD5`	Arabidopsis thaliana	Kunitz trypsin inhibitor 4	35.784%	Swiss-Prot	moderate database homology
`P29421`	Oryza sativa subsp. japonica	Alpha-amylase/subtilisin inhibitor	37.368%	Swiss-Prot	moderate database homology

JBrowse

View in Genome Browser

Gene Card