LXL04_012512 | RubberDandelionOmics

Gene overview

LXL04_012512

Reference: OH-1004 Chr: Chr03 Coordinates: 13556901-13558464 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1302 bp · LXL04_012512|LXL04_012512|OH1004|cDNA

ATGGGGAAGAAGGGGAGTTGGTTTTCTGCAGTCAAAAAAGCTTTAAGCCCTTCTGATTCGAAGGAGAAGAAAGAAAAGAAATCCCATCAAAATACTCCCAAAAAATCATGGTTCGGGAAGCAAAGGAGGTCGGAAAGAGATTTATCACGAATAGAAGTTACATCAGCGTATCCtgccgccgccgccgccgccaCTCGTTCTCCTCCTACAGAAGATGCAAAACTCACTGAAGCCGAAAATGAACAGACAAAACACGCTTA...

CDS

Download CDS FASTA

1302 bp · LXL04_012512|LXL04_012512|OH1004|CDS

ATGGGGAAGAAGGGGAGTTGGTTTTCTGCAGTCAAAAAAGCTTTAAGCCCTTCTGATTCGAAGGAGAAGAAAGAAAAGAAATCCCATCAAAATACTCCCAAAAAATCATGGTTCGGGAAGCAAAGGAGGTCGGAAAGAGATTTATCACGAATAGAAGTTACATCAGCGTATCCTGCCGCCGCCGCCGCCGCCACTCGTTCTCCTCCTACAGAAGATGCAAAACTCACTGAAGCCGAAAATGAACAGACAAAACACGCTTA...

Protein

Download Protein FASTA

433 aa · LXL04_012512|LXL04_012512|OH1004|PROTEIN

MGKKGSWFSAVKKALSPSDSKEKKEKKSHQNTPKKSWFGKQRRSERDLSRIEVTSAYPAAAAAATRSPPTEDAKLTEAENEQTKHAYSVAYATAVAAEAAVAAAQCAAEVVRLTSTSRFLGKSIEDIAAIRIQTAYRGHLARRALRAVRGLGRLKSLIEGQSVKRQATSTLKCMQTLAHVQSQVRSRRLRMSEENQTLKRQLLLKHEKEFNNKSPSGDKWDDSRKSKQEIEARLQSKQEAAIRRERAMAYAHSHQQTLKN...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_012512`
TK1151 ID	TkA02G556830
OH-1004 ID	LXL04_012512
Relationship / confidence	Rbh High Identity Coverage Synteny / Strict
Protein identity (%)	100.000
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_012512

Location Chr03:13556901-13558464 (-)

Description Similar to IQD1: Protein IQ-DOMAIN 1

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At3g52290`	May be involved in cooperative interactions with calmodulins or calmodulin-like proteins (By similarity).	No verified direct reference in this release
`At5g03040`	May be involved in cooperative interactions with calmodulins or calmodulin-like proteins (By similarity).	No verified direct reference in this release
`At3g09710`	May be involved in cooperative interactions with calmodulins or calmodulin-like proteins.	Arabidopsis IQD1, a novel calmodulin-binding nuclear protein, stimulates glucosinolate accumulation and plant defense.2005 · DOI: 10.1111/j.1365-313x.2005.02435.x Arabidopsis calmodulin-binding protein IQ67-domain 1 localizes to microtubules and interacts with kinesin light chain-related protein-1.2013 · DOI: 10.1074/jbc.m112.396200
`At2g26410`	May be involved in cooperative interactions with calmodulins or calmodulin-like proteins (By similarity).	No verified direct reference in this release
`At2g26180`	May be involved in cooperative interactions with calmodulins or calmodulin-like proteins (By similarity).	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_012512 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0006952 defense response Biological Process

GO:0019761 glucosinolate biosynthetic process Biological Process

GO:0005576 extracellular region Cellular Component

GO:0005634 nucleus Cellular Component

GO:0005730 nucleolus Cellular Component

GO:0005856 cytoskeleton Cellular Component

GO:0005874 microtubule Cellular Component

GO:0005886 plasma membrane Cellular Component

GO:0009524 phragmoplast Cellular Component

GO:0009574 preprophase band Cellular Component

GO:0016604 nuclear body Cellular Component

GO:0005516 calmodulin binding Molecular Function

KEGG gene cross-reference

ath:AT2G26180

ath:AT2G26410

ath:AT3G09710

ath:AT3G52290

ath:AT5G03040

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.437

Rank 1 · LXL04_012512 · OH-1004

Cell membrane0.381

Rank 2 · LXL04_012512 · OH-1004

Nucleus0.356

Rank 3 · LXL04_012512 · OH-1004

Endoplasmic reticulum0.044

Rank 4 · LXL04_012512 · OH-1004

Plastid0.034

Rank 5 · LXL04_012512 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

No result was found for this query.

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9FT53`	Arabidopsis thaliana	Protein IQ-DOMAIN 3	52.434%	Swiss-Prot	strong database homology
`Q93ZH7`	Arabidopsis thaliana	Protein IQ-DOMAIN 2	45.553%	Swiss-Prot	moderate database homology
`Q9SF32`	Arabidopsis thaliana	Protein IQ-DOMAIN 1	39.168%	Swiss-Prot	moderate database homology
`F4IUJ7`	Arabidopsis thaliana	Protein IQ-DOMAIN 4	42.143%	Swiss-Prot	moderate database homology
`O64852`	Arabidopsis thaliana	Protein IQ-DOMAIN 6	45.856%	Swiss-Prot	weak database homology

JBrowse

View in Genome Browser

Gene Card