LXL04_012433 | RubberDandelionOmics

Gene overview

LXL04_012433

Reference: OH-1004 Chr: Chr03 Coordinates: 12183416-12184138 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

723 bp · LXL04_012433|LXL04_012433|OH1004|cDNA

ATGTGCACGTTAGAGAAACGCGGTGACATTTACATCCTTACCCTTACCGGCGACGACGACCACCGGTTAAACCCTACGCTACTCGACTCAATCAGCGCCGCCGTCCACCGTGTCCGATCCGAAACCACCACTCCATCCGCCCTCATCACCACCGCACACGGCAGATACTTCTCCAACGGCTACGATCTCGCCTGGTCTCAATCCGATCCAGATCGCCATATCATCATGTCCTCTAAGCTCCGGTCACTTGTTCGAGACCT...

CDS

Download CDS FASTA

723 bp · LXL04_012433|LXL04_012433|OH1004|CDS

ATGTGCACGTTAGAGAAACGCGGTGACATTTACATCCTTACCCTTACCGGCGACGACGACCACCGGTTAAACCCTACGCTACTCGACTCAATCAGCGCCGCCGTCCACCGTGTCCGATCCGAAACCACCACTCCATCCGCCCTCATCACCACCGCACACGGCAGATACTTCTCCAACGGCTACGATCTCGCCTGGTCTCAATCCGATCCAGATCGCCATATCATCATGTCCTCTAAGCTCCGGTCACTTGTTCGAGACCT...

Protein

Download Protein FASTA

240 aa · LXL04_012433|LXL04_012433|OH1004|PROTEIN

MCTLEKRGDIYILTLTGDDDHRLNPTLLDSISAAVHRVRSETTTPSALITTAHGRYFSNGYDLAWSQSDPDRHIIMSSKLRSLVRDLISLPMPTIAAVSGHAAAGGFILAQAHDYVVMRKDRGFLYMSEMDINLVVPDWFVKLLKNKIGSPAAVRDVVLRADKVTAEVAVAKGIIHSAHDTVEETVNAAVVLAEELVMRKWDGHVYGRNRKVLFADVLAAMNFDETVEEVAGANIITSRI

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_012433`
TK1151 ID	TkA02G561470
OH-1004 ID	LXL04_012433
Relationship / confidence	Rbh Below Probable Coverage Or Synteny Threshold / Review
Protein identity (%)	100.000
Protein coverage (%)	TK1151 100.000 / OH-1004 68.750 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_012433

Location Chr03:12183416-12184138 (+)

Description Similar to ECI1: Enoyl-CoA delta isomerase 1, peroxisomal

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At1g65520`	Able to isomerize both 3-cis and 3-trans double bonds into the 2-trans form in a range of enoyl-CoA species.	Peroxisomal Delta(3),Delta(2)-enoyl CoA isomerases and evolution of cytosolic paralogues in embryophytes.2008 · DOI: 10.1111/j.1365-313x.2008.03635.x
`At4g14440`	Able to isomerize both 3-cis and 3-trans double bonds into the 2-trans form in a range of enoyl-CoA species.	Peroxisomal Delta(3),Delta(2)-enoyl CoA isomerases and evolution of cytosolic paralogues in embryophytes.2008 · DOI: 10.1111/j.1365-313x.2008.03635.x
`At4g14430`	Able to isomerize both 3-cis and 3-trans double bonds into the 2-trans form in a range of enoyl-CoA species.	Peroxisomal Delta(3),Delta(2)-enoyl CoA isomerases and evolution of cytosolic paralogues in embryophytes.2008 · DOI: 10.1111/j.1365-313x.2008.03635.x Conversion of endogenous indole-3-butyric acid to indole-3-acetic acid drives cell expansion in Arabidopsis seedlings.2010 · DOI: 10.1104/pp.110.157461

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_012433 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0006635 fatty acid beta-oxidation Biological Process

GO:0009062 fatty acid catabolic process Biological Process

GO:0009437 carnitine metabolic process Biological Process

GO:0048767 root hair elongation Biological Process

GO:0080024 indolebutyric acid metabolic process Biological Process

GO:0080026 response to indolebutyric acid Biological Process

GO:0005634 nucleus Cellular Component

GO:0005737 cytoplasm Cellular Component

GO:0005777 peroxisome Cellular Component

GO:0005829 cytosol Cellular Component

GO:0004165 delta(3)-delta(2)-enoyl-CoA isomerase activity Molecular Function

GO:0008735 L-carnitine CoA-transferase activity Molecular Function

KEGG gene cross-reference

ath:AT1G65520

ath:AT4G14430

ath:AT4G14440

seg:SG0073

ses:SARI_02930

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.579

Rank 1 · LXL04_012433 · OH-1004

Peroxisome0.369

Rank 2 · LXL04_012433 · OH-1004

Nucleus0.211

Rank 3 · LXL04_012433 · OH-1004

Mitochondrion0.057

Rank 4 · LXL04_012433 · OH-1004

Endoplasmic reticulum0.047

Rank 5 · LXL04_012433 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00378.26ECH_123-197 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_012433	`PF00378.26`	ECH_1	23	197	7.1e-23	81.9

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`O04469`	Arabidopsis thaliana	Enoyl-CoA delta isomerase 1, peroxisomal	60.274%	Swiss-Prot	strong database homology
`O23300`	Arabidopsis thaliana	Enoyl-CoA delta isomerase 3	50.000%	Swiss-Prot	strong database homology
`O23299`	Arabidopsis thaliana	Enoyl-CoA delta isomerase 2, peroxisomal	47.863%	Swiss-Prot	moderate database homology

JBrowse

View in Genome Browser

Gene Card