Gene Card
Gene overview
cDNA / CDS / Protein Sequences
945 bp · LXL04_012430|LXL04_012430|OH1004|cDNA
ATGAGCACAGAAGATTTACCAAAGAACGAGGCCCAGGTGTTGAAGGGGCATGAAGGTGCTGTTTTAACGGCAAGGTTCAACAAAGACGGAAATTATTGTCTCACCGGAGGTAAAGATCGGACTATTCGCCTATGGAATCCTCACCGGGGTATTCATATTAAGACGTACAAATCCCATGGTCGTGAAGTTCGAGACGTCCACGTTACAGCAGACAATTCAAAAATCTGTTCATGTGGTGGTGATCGTCAAGTCTTCTATTG...
945 bp · LXL04_012430|LXL04_012430|OH1004|CDS
ATGAGCACAGAAGATTTACCAAAGAACGAGGCCCAGGTGTTGAAGGGGCATGAAGGTGCTGTTTTAACGGCAAGGTTCAACAAAGACGGAAATTATTGTCTCACCGGAGGTAAAGATCGGACTATTCGCCTATGGAATCCTCACCGGGGTATTCATATTAAGACGTACAAATCCCATGGTCGTGAAGTTCGAGACGTCCACGTTACAGCAGACAATTCAAAAATCTGTTCATGTGGTGGTGATCGTCAAGTCTTCTATTG...
Protein
Download Protein FASTA314 aa · LXL04_012430|LXL04_012430|OH1004|PROTEIN
MSTEDLPKNEAQVLKGHEGAVLTARFNKDGNYCLTGGKDRTIRLWNPHRGIHIKTYKSHGREVRDVHVTADNSKICSCGGDRQVFYWDVSTGRVIRKFRGHDSEVNAVKFNEYSSVVVSAGYDRSVRAWDCRSHSTEPIQIIDTFLDSVMSVCLTKTEIIAGSVDGTVRTFDIRMGRELSDDLGQPVNCISLSNDGNCVLASCLDSTLRLLDRTSGELLQEYKGHTCKSFKMDCCLSNSDAYVVGGSEDGRLFFWDLVDA...
Flanking Sequence Download
Sequence orientation and download details
Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.
ID Mapping
| Input ID | LXL04_012430 |
|---|---|
| TK1151 ID | TkA02G561730 |
| OH-1004 ID | LXL04_012430 |
| Relationship / confidence | Rbh High Identity Coverage Synteny / Strict |
| Protein identity (%) | 99.700 |
| Protein coverage (%) | TK1151 100.000 / OH-1004 100.000Coverage and evidenceCoverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation. |
| Source version | OH-1004 / GCA_047496595.1_OSU_TarKok_2.0 |
SNP / Indel variants and carrier samplesCRA009020 · OH-1004
Expand to load variant records for this gene.
Basic Information and Functional Annotation
| Gene ID | LXL04_012430 |
|---|---|
| Location | Chr03:12155147-12156779 (-) |
| Description | Similar to WDR83: WD repeat domain-containing protein 83 |
| Arabidopsis / Rice Reference Genes and Papers |
Download references for this gene ArabidopsisNo hit for this species in the current source table. RiceNo hit for this species in the current source table. |
| Functional annotation source | View annotation sourcesFunctional annotation source: OH1004 · |
| GO annotations (OH1004 source) | GO:0000375 RNA splicing, via transesterification reactions Biological Process GO:0000398 mRNA splicing, via spliceosome Biological Process GO:0001666 response to hypoxia Biological Process GO:0009611 response to wounding Biological Process GO:0032496 response to lipopolysaccharide Biological Process GO:0043122 regulation of canonical NF-kappaB signal transduction Biological Process GO:0005634 nucleus Cellular Component GO:0005681 spliceosomal complex Cellular Component GO:0005737 cytoplasm Cellular Component GO:0005764 lysosome Cellular Component GO:0010008 endosome membrane Cellular Component GO:0071013 catalytic step 2 spliceosome Cellular Component |
| KEGG gene cross-reference | hsa:84292 mmu:67836 rno:288924 xla:734767 xtr:496482 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene. |
Gene expression
View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.
Data sources and gene correspondence
Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.
Subcellular Localization Top 5
Computational predictions or homology annotations below do not replace localization experiments.
LocPro · Direct prediction · Computational prediction, not experimental localization
Predicted Functional Domains
Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.
PF25173.2Beta-prop_WDR3_1st9-173 aaPF25047.1Beta-prop_TEP1_2nd10-133 aaPF00400.39WD4011-46 aaPF24814.2WD40_Prp1911-70 aaPF24105.2Beta-prop_CAF1B_HIR111-96 aaPF24780.2WD40_MABP1-WDR62_1st11-130 aaPF23381.2Beta-prop_IFT122_1st12-80 aaPF24805.2EIF3I13-251 aa| Gene ID | Domain ID | Domain Name | Start aa | End aa | E-value | Score |
|---|---|---|---|---|---|---|
| LXL04_012430 | PF25173.2 | Beta-prop_WDR3_1st | 9 | 173 | 3.6e-35 | 122.1 |
| LXL04_012430 | PF25047.1 | Beta-prop_TEP1_2nd | 10 | 133 | 6.4e-23 | 81.9 |
| LXL04_012430 | PF00400.39 | WD40 | 11 | 46 | 2.8e-40 | 135.7 |
| LXL04_012430 | PF24814.2 | WD40_Prp19 | 11 | 70 | 5.5e-35 | 121.5 |
| LXL04_012430 | PF24105.2 | Beta-prop_CAF1B_HIR1 | 11 | 96 | 8e-15 | 55.4 |
| LXL04_012430 | PF24780.2 | WD40_MABP1-WDR62_1st | 11 | 130 | 1.6e-10 | 41.5 |
| LXL04_012430 | PF23381.2 | Beta-prop_IFT122_1st | 12 | 80 | 1.7e-36 | 126.7 |
| LXL04_012430 | PF24805.2 | EIF3I | 13 | 251 | 2.1e-26 | 93.6 |
| LXL04_012430 | PF25391.2 | WD40_Gbeta | 13 | 156 | 8.4e-19 | 68.5 |
| LXL04_012430 | PF25175.2 | Beta-prop_WDR5 | 14 | 286 | 8.3e-58 | 196.7 |
| LXL04_012430 | PF25174.2 | Beta-prop_THOC3 | 14 | 93 | 8.1e-40 | 137.3 |
| LXL04_012430 | PF25172.2 | Beta-prop_WDR3_2nd | 14 | 130 | 3.4e-25 | 89.6 |
| LXL04_012430 | PF25168.2 | Beta-prop_WDR36-Utp21_2nd | 15 | 148 | 1.9e-23 | 84.0 |
| LXL04_012430 | PF23393.3 | Beta-prop_WDR90_POC16_2nd | 15 | 88 | 1.5e-10 | 41.5 |
| LXL04_012430 | PF13570.14 | Beta-prop_ACSF4 | 25 | 178 | 8.9e-13 | 49.0 |
| LXL04_012430 | PF24782.3 | WD40_MABP1-WDR62_2nd | 27 | 129 | 1.2e-14 | 54.8 |
Arabidopsis / Rice Protein Homology
Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.
No result was found for this query.