LXL04_012409 | RubberDandelionOmics

Gene overview

LXL04_012409

Reference: OH-1004 Chr: Chr03 Coordinates: 11734218-11737245 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

2205 bp · LXL04_012409|LXL04_012409|OH1004|cDNA

ATGTCAATGGCATCTCCATTAACGCTGCTATTCTTACTCACCGTCACCCATTCTCTCATCTTTAGCAACACTCTAGGAGCTGACACCGATCTCAAGACCTACATTGTGTACATGGGTGACCTTCCTAAGACTAAGACTGATTTCTCCGTGGAAGCAGCCCATTCAAACATCCTACAGCAAGTTATTGGCAGCCGTGCATCAACATCTTTACTCCGGAGCTACAAACGAAGCTTTAATGGCTTCGTTGCCAAGCTAACTGA...

CDS

Download CDS FASTA

2205 bp · LXL04_012409|LXL04_012409|OH1004|CDS

ATGTCAATGGCATCTCCATTAACGCTGCTATTCTTACTCACCGTCACCCATTCTCTCATCTTTAGCAACACTCTAGGAGCTGACACCGATCTCAAGACCTACATTGTGTACATGGGTGACCTTCCTAAGACTAAGACTGATTTCTCCGTGGAAGCAGCCCATTCAAACATCCTACAGCAAGTTATTGGCAGCCGTGCATCAACATCTTTACTCCGGAGCTACAAACGAAGCTTTAATGGCTTCGTTGCCAAGCTAACTGA...

Protein

Download Protein FASTA

734 aa · LXL04_012409|LXL04_012409|OH1004|PROTEIN

MSMASPLTLLFLLTVTHSLIFSNTLGADTDLKTYIVYMGDLPKTKTDFSVEAAHSNILQQVIGSRASTSLLRSYKRSFNGFVAKLTEEEKNQLAQMEGVVSVFPNQKKQLHTTRSWDFMGFPQDVKRATLESDVIVGMLDTGVWPESDSFKDDGFGAPPAKWKGSCSSKNFTCNKKLIGAKYFLTDGADAGDEEPSVRDTEGHGTHTASTVAGRAVNNASMLGLGQGTARGGVPSARIAVYKICWPGGCSDADILAAFDE...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_012409`
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_012409

Location Chr03:11734218-11737245 (+)

Description Similar to Cucumisin

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At5g59100`	Subtilisin-like protease SBT4.4.	No verified direct reference in this release
`At5g59090`	Subtilisin-like protease SBT4.12.	No verified direct reference in this release
`At5g59190`	Subtilisin-like protease SBT4.3.	No verified direct reference in this release
`At5g58840`	Subtilisin-like protease SBT4.9.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_012409 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0006508 proteolysis Biological Process

GO:0009609 response to symbiotic bacterium Biological Process

GO:0009753 response to jasmonic acid Biological Process

GO:0046686 response to cadmium ion Biological Process

GO:0005576 extracellular region Cellular Component

GO:0005634 nucleus Cellular Component

GO:0005737 cytoplasm Cellular Component

GO:0004252 serine-type endopeptidase activity Molecular Function

KEGG gene cross-reference

ath:AT5G58840

ath:AT5G59090

ath:AT5G59100

ath:AT5G59190

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Extracellular0.625

Rank 1 · LXL04_012409 · OH-1004

Lysosome / Vacuole0.120

Rank 2 · LXL04_012409 · OH-1004

Cell membrane0.091

Rank 3 · LXL04_012409 · OH-1004

Cytoplasm0.080

Rank 4 · LXL04_012409 · OH-1004

Endoplasmic reticulum0.071

Rank 5 · LXL04_012409 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF05922.22Inhibitor_I933-111 aa

PF00082.28Peptidase_S8132-578 aa

PF17766.8fn3_6635-730 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_012409	`PF05922.22`	Inhibitor_I9	33	111	2.6e-18	67.2
LXL04_012409	`PF00082.28`	Peptidase_S8	132	578	1.1e-45	156.9
LXL04_012409	`PF17766.8`	fn3_6	635	730	1e-29	103.3

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9FGU3`	Arabidopsis thaliana	Subtilisin-like protease SBT4.4	49.512%	Swiss-Prot	moderate database homology
`Q8L7D2`	Arabidopsis thaliana	Subtilisin-like protease SBT4.12	49.588%	Swiss-Prot	moderate database homology
`Q9FIF8`	Arabidopsis thaliana	Subtilisin-like protease SBT4.3	49.664%	Swiss-Prot	moderate database homology
`Q9FIM5`	Arabidopsis thaliana	Subtilisin-like protease SBT4.9	49.093%	Swiss-Prot	moderate database homology

JBrowse

View in Genome Browser

Gene Card