LXL04_012382 | RubberDandelionOmics

Gene overview

LXL04_012382

Reference: OH-1004 Chr: Chr03 Coordinates: 11423633-11424235 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

603 bp · LXL04_012382|LXL04_012382|OH1004|cDNA

ATGGAGCAATACTCACAATACTTGATGTTGGTGAAGAGCGACAACAGCAATATCCATGTGAACCCATTTTCCGGCCATTCATGGGAAGAACAAGCTTTCGCAGAAGACGCTCGAGGCCCTTTTGGGGGGTTCGTATGGCCTCCGAGGTCTTATTCATGTAGCTTCTGTAAAAGAGATTTCAGGTCAGCTCAAGCCCTAGGTGGTCACATGAATGTCCATAGAAAAGAAAGAGCGAAGCTCAAGCATTCTACACCCAAAGT...

CDS

Download CDS FASTA

603 bp · LXL04_012382|LXL04_012382|OH1004|CDS

ATGGAGCAATACTCACAATACTTGATGTTGGTGAAGAGCGACAACAGCAATATCCATGTGAACCCATTTTCCGGCCATTCATGGGAAGAACAAGCTTTCGCAGAAGACGCTCGAGGCCCTTTTGGGGGGTTCGTATGGCCTCCGAGGTCTTATTCATGTAGCTTCTGTAAAAGAGATTTCAGGTCAGCTCAAGCCCTAGGTGGTCACATGAATGTCCATAGAAAAGAAAGAGCGAAGCTCAAGCATTCTACACCCAAAGT...

Protein

Download Protein FASTA

200 aa · LXL04_012382|LXL04_012382|OH1004|PROTEIN

MEQYSQYLMLVKSDNSNIHVNPFSGHSWEEQAFAEDARGPFGGFVWPPRSYSCSFCKRDFRSAQALGGHMNVHRKERAKLKHSTPKVPPQNPNYKQNVCNKESLVDPGFCTLALSPSRVSSIPALGEESFDTNNSDTKSYVYDEDFAVLGHGNGDVETNLVLGFEFDSCSNTVSGCKRQKTAGVTPPSMEGLDLELRLGS

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_012382`
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_012382

Location Chr03:11423633-11424235 (+)

Description Similar to RBE: Probable transcriptional regulator RABBIT EARS

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At5g06070`	Probable transcriptional regulator essential for petal development.	No verified direct reference in this release
`At2g37740`	Probable transcription factor that may regulate cell division and growth.	Ectopic expression of an Arabidopsis single zinc finger gene in tobacco results in dwarf plants.2002 · DOI: 10.1093/pcp/pcf086
`At3g23130`	Probable transcriptional regulator considered as cadastral protein that acts indirectly to prevent the B class homeotic proteins APETALA3 and perhaps PISTILLATA from acting in the gynoecial whorl.	Regulation of SUP expression identifies multiple regulators involved in arabidopsis floral meristem development.2000 · DOI: 10.1105/tpc.12.9.1607 The FLO10 Gene Product Regulates the Expression Domain of Homeotic Genes AP3 and PI in Arabidopsis Flowers.1991 · DOI: 10.1105/tpc.3.11.1221
`At2g42410`	Probable transcription factor that may regulate cell division and growth.	No verified direct reference in this release
`At3g09290`	Activation factor which mediates telomerase activity and potentiates responses to auxin through the regulation of BT2.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_012382 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0006351 DNA-templated transcription Biological Process

GO:0006355 regulation of DNA-templated transcription Biological Process

GO:0008361 regulation of cell size Biological Process

GO:0009409 response to cold Biological Process

GO:0009755 hormone-mediated signaling pathway Biological Process

GO:0009908 flower development Biological Process

GO:0010093 specification of floral organ identity Biological Process

GO:0030154 cell differentiation Biological Process

GO:0042127 regulation of cell population proliferation Biological Process

GO:0045892 negative regulation of DNA-templated transcription Biological Process

GO:0048441 petal development Biological Process

GO:0090691 formation of plant organ boundary Biological Process

KEGG gene cross-reference

ath:AT2G37740

ath:AT2G42410

ath:AT3G09290

ath:AT3G23130

ath:AT5G06070

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.972

Rank 1 · LXL04_012382 · OH-1004

Cytoplasm0.086

Rank 2 · LXL04_012382 · OH-1004

Cell membrane0.029

Rank 3 · LXL04_012382 · OH-1004

Endoplasmic reticulum0.018

Rank 4 · LXL04_012382 · OH-1004

Plastid0.011

Rank 5 · LXL04_012382 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF13912.13zf-C2H2_651-76 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_012382	`PF13912.13`	zf-C2H2_6	51	76	3.8e-06	27.4

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9LHS9`	Arabidopsis thaliana	Probable transcriptional regulator RABBIT EARS	38.308%	Swiss-Prot	moderate database homology
`O80942`	Arabidopsis thaliana	Zinc finger protein 10	68.421%	Swiss-Prot	weak database homology
`Q38895`	Arabidopsis thaliana	Transcriptional regulator SUPERMAN	82.051%	Swiss-Prot	weak database homology
`Q9SLB8`	Arabidopsis thaliana	Zinc finger protein 11	42.857%	Swiss-Prot	weak database homology
`Q9SR34`	Arabidopsis thaliana	Transcriptional regulator TAC1	72.727%	Swiss-Prot	weak database homology

JBrowse

View in Genome Browser

Gene Card