LXL04_012239 | RubberDandelionOmics

Gene overview

LXL04_012239

Reference: OH-1004 Chr: Chr03 Coordinates: 8940647-8942878 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

2232 bp · LXL04_012239|LXL04_012239|OH1004|cDNA

ATGGTGGATCCTGATCCCCCTGGCAATGAGGAAAATCTTATTGATAATAGCAACAACAATGACACCAATAGTAGCAATGACAACAACAATGGTAACGACGGTGACAACACTACTAATGACGGTGGCAACACTACTAACGACGGTCGTAACACTACTAATGACAATGCTAGTGGCAACAATAACGACAATGGAAATGAGGATGGTAGTGCCAATAGTAATCATAGTTTGACTCTCAACGACAATGATgacaacaacaacac...

CDS

Download CDS FASTA

2232 bp · LXL04_012239|LXL04_012239|OH1004|CDS

ATGGTGGATCCTGATCCCCCTGGCAATGAGGAAAATCTTATTGATAATAGCAACAACAATGACACCAATAGTAGCAATGACAACAACAATGGTAACGACGGTGACAACACTACTAATGACGGTGGCAACACTACTAACGACGGTCGTAACACTACTAATGACAATGCTAGTGGCAACAATAACGACAATGGAAATGAGGATGGTAGTGCCAATAGTAATCATAGTTTGACTCTCAACGACAATGATGACAACAACAACAC...

Protein

Download Protein FASTA

743 aa · LXL04_012239|LXL04_012239|OH1004|PROTEIN

MVDPDPPGNEENLIDNSNNNDTNSSNDNNNGNDGDNTTNDGGNTTNDGRNTTNDNASGNNNDNGNEDGSANSNHSLTLNDNDDNNNTNTNTNTNTSNNSNDNDNDNNTNTNTSNNSNDNDTSNNDGDGNINDHDSLAIGQGMNIEDDPKKQSCVCVRRDFFPEESFKSWSNYGKALLATRARLKERLLARSSDDNEIHGMRARSQNQMKRTLNWFDLIWFGVGAVMGAGVFVLTGEAAHDLAGPAVLISYLVSGCAALLS...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_012239`
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_012239

Location Chr03:8940647-8942878 (+)

Description Similar to CAT1: Cationic amino acid transporter 1

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At4g21120`	High-affinity permease involved in the transport of the cationic amino acids (e.g. arginine, lysine, histidine, citrulline, valine, and glutamate).	No verified direct reference in this release
`At2g34960`	High-affinity permease involved in the transport of the cationic amino acids (e.g. arginine, and, to a lower extent, citrulline and glutamate).	Molecular and functional characterization of a family of amino acid transporters from Arabidopsis.2004 · DOI: 10.1104/pp.104.045278
`At1g17120`	Permease involved in the transport of the cationic neutral or acidic amino acids.	Molecular and functional characterization of a family of amino acid transporters from Arabidopsis.2004 · DOI: 10.1104/pp.104.045278
`At5g04770`	Permease involved in the transport of the cationic neutral or acidic amino acids.	Molecular and functional characterization of a family of amino acid transporters from Arabidopsis.2004 · DOI: 10.1104/pp.104.045278
`At3g10600`	Permease involved in the transport of the cationic amino acids.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_012239 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0006865 amino acid transport Biological Process

GO:0009624 response to nematode Biological Process

GO:0000325 plant-type vacuole Cellular Component

GO:0005737 cytoplasm Cellular Component

GO:0005739 mitochondrion Cellular Component

GO:0005886 plasma membrane Cellular Component

GO:0009507 chloroplast Cellular Component

GO:0016020 membrane Cellular Component

GO:0031969 chloroplast membrane Cellular Component

GO:0015171 amino acid transmembrane transporter activity Molecular Function

KEGG gene cross-reference

ath:AT1G17120

ath:AT2G34960

ath:AT3G10600

ath:AT4G21120

ath:AT5G04770

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cell membrane0.674

Rank 1 · LXL04_012239 · OH-1004

Lysosome / Vacuole0.143

Rank 2 · LXL04_012239 · OH-1004

Endoplasmic reticulum0.104

Rank 3 · LXL04_012239 · OH-1004

Cytoplasm0.092

Rank 4 · LXL04_012239 · OH-1004

Golgi apparatus0.049

Rank 5 · LXL04_012239 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF13520.13AA_permease_2212-582 aa

PF00324.28AA_permease217-572 aa

PF13906.13AA_permease_C651-700 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_012239	`PF13520.13`	AA_permease_2	212	582	2.9e-40	139.2
LXL04_012239	`PF00324.28`	AA_permease	217	572	3.2e-32	112.6
LXL04_012239	`PF13906.13`	AA_permease_C	651	700	7.5e-16	58.7

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q84MA5`	Arabidopsis thaliana	Cationic amino acid transporter 1	58.722%	Swiss-Prot	strong database homology
`O64759`	Arabidopsis thaliana	Cationic amino acid transporter 5	55.054%	Swiss-Prot	strong database homology
`Q9SHH0`	Arabidopsis thaliana	Cationic amino acid transporter 8, vacuolar	50.266%	Swiss-Prot	strong database homology
`Q9LZ20`	Arabidopsis thaliana	Cationic amino acid transporter 6, chloroplastic	37.696%	Swiss-Prot	moderate database homology
`Q9SQZ0`	Arabidopsis thaliana	Cationic amino acid transporter 7, chloroplastic	36.934%	Swiss-Prot	moderate database homology

JBrowse

View in Genome Browser

Gene Card