Gene Card
Gene overview
cDNA / CDS / Protein Sequences
2571 bp · LXL04_012237|LXL04_012237|OH1004|cDNA
ATGGCATCAACCGTCCGCCACCAGCTGCCACCTTCTCATCCTTCCGACTCCGACTCTTCCGACTCAGACTCCTCTACAAAACCCCTCCAACACACCGACTTTTCCAACACAATCTTCAGATCCTACATAGAGATCTCCGGTCTTGAATCCCCGGACCTCACTAAAATCCGATCTTTCCTAACCTCATCACGCTCCGGTGCACTATCATGTCTCATATGTCTCGAACGAATTCGCCCCACAGATCCCACTTGGTCCTGCTC...
2571 bp · LXL04_012237|LXL04_012237|OH1004|CDS
ATGGCATCAACCGTCCGCCACCAGCTGCCACCTTCTCATCCTTCCGACTCCGACTCTTCCGACTCAGACTCCTCTACAAAACCCCTCCAACACACCGACTTTTCCAACACAATCTTCAGATCCTACATAGAGATCTCCGGTCTTGAATCCCCGGACCTCACTAAAATCCGATCTTTCCTAACCTCATCACGCTCCGGTGCACTATCATGTCTCATATGTCTCGAACGAATTCGCCCCACAGATCCCACTTGGTCCTGCTC...
Protein
Download Protein FASTA856 aa · LXL04_012237|LXL04_012237|OH1004|PROTEIN
MASTVRHQLPPSHPSDSDSSDSDSSTKPLQHTDFSNTIFRSYIEISGLESPDLTKIRSFLTSSRSGALSCLICLERIRPTDPTWSCSSRCFAVFHLLCIQSWARQSSDLSSIRAASRGADDRNSNWNCPKCRIEFPKTLIPKTYTCFCGKIENPPHDPWILPHSCGEICNRSLKYDCGHRCLLLCHPGPCPACPKLVKTRCFCGGVEDIKRCGFKDFSCNKTCSKLLACKAHCCPETCHSGECPPCKTTGTYNCHCGKVK...
Flanking Sequence Download
Sequence orientation and download details
Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.
ID Mapping
| Input ID | LXL04_012237 |
|---|---|
| Source version | OH-1004 / GCA_047496595.1_OSU_TarKok_2.0 |
SNP / Indel variants and carrier samplesCRA009020 · OH-1004
Expand to load variant records for this gene.
Basic Information and Functional Annotation
| Gene ID | LXL04_012237 | |||||||||
|---|---|---|---|---|---|---|---|---|---|---|
| Location | Chr03:8923914-8927762 (-) | |||||||||
| Description | Similar to NFXL2: NF-X1-type zinc finger protein NFXL2 | |||||||||
| Arabidopsis / Rice Reference Genes and Papers |
Download references for this gene Arabidopsis
RiceNo hit for this species in the current source table. | |||||||||
| Functional annotation source | View annotation sourcesFunctional annotation source: OH1004 · | |||||||||
| GO annotations (OH1004 source) | GO:0000122 negative regulation of transcription by RNA polymerase II Biological Process GO:0006351 DNA-templated transcription Biological Process GO:0006355 regulation of DNA-templated transcription Biological Process GO:0007623 circadian rhythm Biological Process GO:0009651 response to salt stress Biological Process GO:0009908 flower development Biological Process GO:0010310 regulation of hydrogen peroxide metabolic process Biological Process GO:0016567 protein ubiquitination Biological Process GO:0045892 negative regulation of DNA-templated transcription Biological Process GO:0045893 positive regulation of DNA-templated transcription Biological Process GO:0051865 protein autoubiquitination Biological Process GO:0160062 cutin-based cuticle development Biological Process | |||||||||
| KEGG gene cross-reference | ath:AT5G05660 dme:Dmel_CG3647 hsa:152518 xla:779353 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene. |
Gene expression
View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.
Data sources and gene correspondence
Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.
Subcellular Localization Top 5
Computational predictions or homology annotations below do not replace localization experiments.
LocPro · Direct prediction · Computational prediction, not experimental localization
Predicted Functional Domains
Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.
PF01422.23zf-NF-X1388-406 aa| Gene ID | Domain ID | Domain Name | Start aa | End aa | E-value | Score |
|---|---|---|---|---|---|---|
| LXL04_012237 | PF01422.23 | zf-NF-X1 | 388 | 406 | 6.6e-06 | 26.8 |
Arabidopsis / Rice Protein Homology
Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.