LXL04_012200 | RubberDandelionOmics

Gene overview

LXL04_012200

Reference: OH-1004 Chr: Chr03 Coordinates: 8202645-8204384 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

765 bp · LXL04_012200|LXL04_012200|OH1004|cDNA

ATGCTTCTAAGAGCTCCCCCGACTATCTTCTCGCGGAACGGTGCTACCGTAAGCTGCGGGGAGAATTTCAGTGGTTCTAAGCTATCATCTTCCTCTGTTTCCCCTCCGTCGGTTATCGTTTGTGCGGCGGCCAAAGGTGCTTCGAATAATAGGCCGATTACGGGTGTTGTGTTTGAGCCTTTTGAAGAGGTCAAAAAAGAGCTCAATCTCGTCCCTAATGTTCCTCAGCAGTCTATTGCTCGGCAAAAATACGCTGATGA...

CDS

Download CDS FASTA

765 bp · LXL04_012200|LXL04_012200|OH1004|CDS

ATGCTTCTAAGAGCTCCCCCGACTATCTTCTCGCGGAACGGTGCTACCGTAAGCTGCGGGGAGAATTTCAGTGGTTCTAAGCTATCATCTTCCTCTGTTTCCCCTCCGTCGGTTATCGTTTGTGCGGCGGCCAAAGGTGCTTCGAATAATAGGCCGATTACGGGTGTTGTGTTTGAGCCTTTTGAAGAGGTCAAAAAAGAGCTCAATCTCGTCCCTAATGTTCCTCAGCAGTCTATTGCTCGGCAAAAATACGCTGATGA...

Protein

Download Protein FASTA

254 aa · LXL04_012200|LXL04_012200|OH1004|PROTEIN

MLLRAPPTIFSRNGATVSCGENFSGSKLSSSSVSPPSVIVCAAAKGASNNRPITGVVFEPFEEVKKELNLVPNVPQQSIARQKYADDSEAVINEQINVEYNVSYVYHAMYAYFDRDNVALKGLAKFFKESSEEERGHAEMFMEYQNKRGGKVKLQSILMPLSEFDHAEKGDALYAMELALSLEKLTNEKLLHVHAVANKNNDVQLADFVESEFLGEQVEAIKKISEYVAQLRRVGKGHGVWHFDQMLLNEGAAA

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_012200`
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_012200

Location Chr03:8202645-8204384 (+)

Description Similar to Ferritin-3, chloroplastic

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At3g11050`	Stores iron in a soluble, non-toxic, readily available form.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_012200 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0006826 iron ion transport Biological Process

GO:0006879 intracellular iron ion homeostasis Biological Process

GO:0006979 response to oxidative stress Biological Process

GO:0009737 response to abscisic acid Biological Process

GO:0005737 cytoplasm Cellular Component

GO:0009507 chloroplast Cellular Component

GO:0004322 ferroxidase activity Molecular Function

GO:0008198 ferrous iron binding Molecular Function

GO:0008199 ferric iron binding Molecular Function

KEGG gene cross-reference

ath:AT3G11050

gmx:547476

gmx:547477

nta:107832545

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Plastid0.918

Rank 1 · LXL04_012200 · OH-1004

Mitochondrion0.084

Rank 2 · LXL04_012200 · OH-1004

Cytoplasm0.053

Rank 3 · LXL04_012200 · OH-1004

Nucleus0.025

Rank 4 · LXL04_012200 · OH-1004

Peroxisome0.024

Rank 5 · LXL04_012200 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00210.31Ferritin91-234 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_012200	`PF00210.31`	Ferritin	91	234	2.2e-32	112.7

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9SRL5`	Arabidopsis thaliana	Ferritin-2, chloroplastic	71.825%	Swiss-Prot	strong database homology

JBrowse

View in Genome Browser

Gene Card