LXL04_012096 | RubberDandelionOmics

Gene overview

LXL04_012096

Reference: OH-1004 Chr: Chr03 Coordinates: 6274172-6277063 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

2892 bp · LXL04_012096|LXL04_012096|OH1004|cDNA

ATGACTTCCCAAACATTTATTTGCGTTCTCACAATCTTTACATTGTTTCACTCTTCTTTATGTCTCGAATACGAGAAAACCGCACTTCTGGAGTTCAAGAACGGCCTCATCGATTCTGCCGATCTTCTCTTTTCCTGGAACAAAAGCAGCCAAGATTGCTGCACATGGTACGGCATAACCTGCAACAATAAAACGGGTCGGGTAACCGAGATCCGACTCCGTGGCCCAGACGCCATGGCTGATTCAGACAACCCAGAAGC...

CDS

Download CDS FASTA

2892 bp · LXL04_012096|LXL04_012096|OH1004|CDS

ATGACTTCCCAAACATTTATTTGCGTTCTCACAATCTTTACATTGTTTCACTCTTCTTTATGTCTCGAATACGAGAAAACCGCACTTCTGGAGTTCAAGAACGGCCTCATCGATTCTGCCGATCTTCTCTTTTCCTGGAACAAAAGCAGCCAAGATTGCTGCACATGGTACGGCATAACCTGCAACAATAAAACGGGTCGGGTAACCGAGATCCGACTCCGTGGCCCAGACGCCATGGCTGATTCAGACAACCCAGAAGC...

Protein

Download Protein FASTA

963 aa · LXL04_012096|LXL04_012096|OH1004|PROTEIN

MTSQTFICVLTIFTLFHSSLCLEYEKTALLEFKNGLIDSADLLFSWNKSSQDCCTWYGITCNNKTGRVTEIRLRGPDAMADSDNPEAPVQKLGGKLNSALRNLTSLQYLDLSSNDFGGNPIPTFIGSLRSLTYLNLSDSEFSGEIPSQLGNLTALRVLGIRNSYSSDQYELRAESLQWLSGVSRLRHLDMDGVQLGQAFDWSQVTRTLLPSSLVELHLSNCGLPPITPNLTVNLTSLSILDLSYNNFSTNSIPIWISSLR...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_012096`
TK1151 ID	TkA02G587780
OH-1004 ID	LXL04_012096
Relationship / confidence	Rbh Below Probable Coverage Or Synteny Threshold / Review
Protein identity (%)	60.700
Protein coverage (%)	TK1151 100.000 / OH-1004 91.900 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_012096

Location Chr03:6274172-6277063 (-)

Description Similar to EIX2: Receptor-like protein EIX2

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At4g13920`	Receptor-like protein 50.	No verified direct reference in this release
`At5g27060`	Receptor-like protein 53.	No verified direct reference in this release
`At1g47890`	Receptor-like protein 7.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_012096 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0002220 innate immune response activating cell surface receptor signaling pathway Biological Process

GO:0007165 signal transduction Biological Process

GO:0050832 defense response to fungus Biological Process

GO:0005576 extracellular region Cellular Component

GO:0005886 plasma membrane Cellular Component

KEGG gene cross-reference

ath:AT1G47890

ath:AT4G13920

ath:AT5G27060

sly:543900

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cell membrane0.877

Rank 1 · LXL04_012096 · OH-1004

Endoplasmic reticulum0.089

Rank 2 · LXL04_012096 · OH-1004

Cytoplasm0.054

Rank 3 · LXL04_012096 · OH-1004

Nucleus0.041

Rank 4 · LXL04_012096 · OH-1004

Lysosome / Vacuole0.024

Rank 5 · LXL04_012096 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF08263.18LRRNT_224-62 aa

PF23598.2LRR_1495-217 aa

PF13855.13LRR_8212-272 aa

PF23598.2LRR_14229-352 aa

PF12799.14LRR_4285-315 aa

PF13855.13LRR_8355-397 aa

PF23598.2LRR_14357-534 aa

PF13855.13LRR_8386-445 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_012096	`PF08263.18`	LRRNT_2	24	62	9.1e-14	52.2
LXL04_012096	`PF23598.2`	LRR_14	95	217	5.2e-51	174.2
LXL04_012096	`PF13855.13`	LRR_8	212	272	1.1e-49	166.7
LXL04_012096	`PF23598.2`	LRR_14	229	352	5.2e-51	174.2
LXL04_012096	`PF12799.14`	LRR_4	285	315	3.3e-32	110.5
LXL04_012096	`PF13855.13`	LRR_8	355	397	1.1e-49	166.7
LXL04_012096	`PF23598.2`	LRR_14	357	534	5.2e-51	174.2
LXL04_012096	`PF13855.13`	LRR_8	386	445	1.1e-49	166.7
LXL04_012096	`PF13855.13`	LRR_8	588	644	1.1e-49	166.7
LXL04_012096	`PF13855.13`	LRR_8	657	717	1.1e-49	166.7
LXL04_012096	`PF23598.2`	LRR_14	787	866	5.2e-51	174.2
LXL04_012096	`PF13855.13`	LRR_8	794	852	1.1e-49	166.7

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q93YT3`	Arabidopsis thaliana	Receptor-like protein 50	31.162%	Swiss-Prot	moderate database homology
`Q9S9U3`	Arabidopsis thaliana	Receptor-like protein 53	30.150%	Swiss-Prot	moderate database homology
`Q9C699`	Arabidopsis thaliana	Receptor-like protein 7	30.930%	Swiss-Prot	moderate database homology

JBrowse

View in Genome Browser

Gene Card