LXL04_012094 | RubberDandelionOmics

Gene overview

LXL04_012094

Reference: OH-1004 Chr: Chr03 Coordinates: 6241389-6244928 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

3198 bp · LXL04_012094|LXL04_012094|OH1004|cDNA

ATGAAATCTTCCACACTTCCTTCTTCTTTACTACTTCAACTTCTCATTATTTTATCACTATGTTATTGTTGCCAATCAATTCAAAGCTCTAATCATGTTCTATGCATCAAGAGCGAGAAAGCATCACTTCTAAAGTTCAAATCCGACCTCATAGACACTACCAATCGCCTCTCTTCTTGGAGTATTAGCAACAACACCGATTGTTGCAAATGGGCCGGTGTGGTTTGCAATAACATTACGGGCCATGTCCAAGAGCTTCA...

CDS

Download CDS FASTA

3198 bp · LXL04_012094|LXL04_012094|OH1004|CDS

ATGAAATCTTCCACACTTCCTTCTTCTTTACTACTTCAACTTCTCATTATTTTATCACTATGTTATTGTTGCCAATCAATTCAAAGCTCTAATCATGTTCTATGCATCAAGAGCGAGAAAGCATCACTTCTAAAGTTCAAATCCGACCTCATAGACACTACCAATCGCCTCTCTTCTTGGAGTATTAGCAACAACACCGATTGTTGCAAATGGGCCGGTGTGGTTTGCAATAACATTACGGGCCATGTCCAAGAGCTTCA...

Protein

Download Protein FASTA

1065 aa · LXL04_012094|LXL04_012094|OH1004|PROTEIN

MKSSTLPSSLLLQLLIILSLCYCCQSIQSSNHVLCIKSEKASLLKFKSDLIDTTNRLSSWSISNNTDCCKWAGVVCNNITGHVQELHLGGPNDGLHGHCHGSYDTDDELEAASMQMLGGDINPSLLSLKQLHHLDLSCNDFGGIQIPNFITSMRNLTYVNLSMSQFDGQIPTNLGNLTNLRVLDLRFGLWQSVFPVKNLEWLTRLRMLQRLDLTGYDLSSEVDWLQVMNTLPSLLELRLSSCSLPQIPRHINTVNFTSLS...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_012094`
TK1151 ID	TkA02G587860
OH-1004 ID	LXL04_012094
Relationship / confidence	Rbh High Identity Coverage Synteny / Strict
Protein identity (%)	99.200
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_012094

Location Chr03:6241389-6244928 (-)

Description Similar to EIX2: Receptor-like protein EIX2

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At4g13920`	Receptor-like protein 50.	No verified direct reference in this release
`At4g04220`	Receptor-like protein 46.	No verified direct reference in this release
`At2g15080`	Receptor-like protein 19.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_012094 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0002220 innate immune response activating cell surface receptor signaling pathway Biological Process

GO:0007165 signal transduction Biological Process

GO:0050832 defense response to fungus Biological Process

GO:0005576 extracellular region Cellular Component

GO:0005886 plasma membrane Cellular Component

KEGG gene cross-reference

ath:AT4G04220

ath:AT4G13920

sly:543900

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cell membrane0.863

Rank 1 · LXL04_012094 · OH-1004

Endoplasmic reticulum0.093

Rank 2 · LXL04_012094 · OH-1004

Cytoplasm0.056

Rank 3 · LXL04_012094 · OH-1004

Nucleus0.046

Rank 4 · LXL04_012094 · OH-1004

Lysosome / Vacuole0.024

Rank 5 · LXL04_012094 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF08263.18LRRNT_237-77 aa

PF23598.2LRR_14123-265 aa

PF23598.2LRR_14273-467 aa

PF13855.13LRR_8334-393 aa

PF23598.2LRR_14424-588 aa

PF12799.14LRR_4434-474 aa

PF13855.13LRR_8435-494 aa

PF23598.2LRR_14449-628 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_012094	`PF08263.18`	LRRNT_2	37	77	1.2e-11	45.4
LXL04_012094	`PF23598.2`	LRR_14	123	265	9.7e-51	173.3
LXL04_012094	`PF23598.2`	LRR_14	273	467	9.7e-51	173.3
LXL04_012094	`PF13855.13`	LRR_8	334	393	9.9e-51	170.1
LXL04_012094	`PF23598.2`	LRR_14	424	588	9.7e-51	173.3
LXL04_012094	`PF12799.14`	LRR_4	434	474	4.7e-36	122.7
LXL04_012094	`PF13855.13`	LRR_8	435	494	9.9e-51	170.1
LXL04_012094	`PF23598.2`	LRR_14	449	628	9.7e-51	173.3
LXL04_012094	`PF13855.13`	LRR_8	680	740	9.9e-51	170.1
LXL04_012094	`PF13855.13`	LRR_8	752	813	9.9e-51	170.1
LXL04_012094	`PF13855.13`	LRR_8	868	903	9.9e-51	170.1
LXL04_012094	`PF12799.14`	LRR_4	870	903	4.7e-36	122.7
LXL04_012094	`PF23598.2`	LRR_14	872	950	9.7e-51	173.3

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q93YT3`	Arabidopsis thaliana	Receptor-like protein 50	31.093%	Swiss-Prot	moderate database homology
`F4JGB6`	Arabidopsis thaliana	Receptor-like protein 46	32.659%	Swiss-Prot	moderate database homology
`Q9ZUK3`	Arabidopsis thaliana	Receptor-like protein 19	29.038%	Swiss-Prot	weak database homology

JBrowse

View in Genome Browser

Gene Card