Gene Card
Gene overview
cDNA / CDS / Protein Sequences
954 bp · LXL04_012093|LXL04_012093|OH1004|cDNA
ATGGTATGTTCGGCTCGGATACTGGATGCTTCATATCCCCTAACGCCGTCGATCTCCTCTTATGTTCCGTCTTTGCATCATAACTCCAGATACTTATGTCGAAACCTAAAATCTACCGTCAGATGGCGATCGATGGCGACGTCTGATCCAGATGCTTCTATGTTCGCAGCTGCTGCCTCGGCTGATGCTGATTTAGCGGAGAAAAACGCTGCAGGGTTCTGTATTATCGAAGGACCTGAAACAGTTCAGGACTTTGAAAA...
954 bp · LXL04_012093|LXL04_012093|OH1004|CDS
ATGGTATGTTCGGCTCGGATACTGGATGCTTCATATCCCCTAACGCCGTCGATCTCCTCTTATGTTCCGTCTTTGCATCATAACTCCAGATACTTATGTCGAAACCTAAAATCTACCGTCAGATGGCGATCGATGGCGACGTCTGATCCAGATGCTTCTATGTTCGCAGCTGCTGCCTCGGCTGATGCTGATTTAGCGGAGAAAAACGCTGCAGGGTTCTGTATTATCGAAGGACCTGAAACAGTTCAGGACTTTGAAAA...
Protein
Download Protein FASTA317 aa · LXL04_012093|LXL04_012093|OH1004|PROTEIN
MVCSARILDASYPLTPSISSYVPSLHHNSRYLCRNLKSTVRWRSMATSDPDASMFAAAASADADLAEKNAAGFCIIEGPETVQDFEKMDVQEIQDNIRSRRNKIFLHMEEVRRLRIQQRIKSAELGIPDEEQEGELPDFPSFIPFLPPLTSANLKQYYATCFSLISGIIIFGGLLAPTLELKLGIGGTSYADFISNMHLPMQLSDVDPIVASFSGGAVGVISALMVVEINNVKQQEHKRCKYCLGTGYLACARCATTGAI...
Flanking Sequence Download
Sequence orientation and download details
Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.
ID Mapping
| Input ID | LXL04_012093 |
|---|---|
| Source version | OH-1004 / GCA_047496595.1_OSU_TarKok_2.0 |
SNP / Indel variants and carrier samplesCRA009020 · OH-1004
Expand to load variant records for this gene.
Basic Information and Functional Annotation
| Gene ID | LXL04_012093 | |||||||||
|---|---|---|---|---|---|---|---|---|---|---|
| Location | Chr03:6239506-6241386 (+) | |||||||||
| Description | Similar to OR: Protein ORANGE, chloroplastic | |||||||||
| Arabidopsis / Rice Reference Genes and Papers |
Download references for this gene Arabidopsis
RiceNo hit for this species in the current source table. | |||||||||
| Functional annotation source | View annotation sourcesFunctional annotation source: OH1004 · | |||||||||
| GO annotations (OH1004 source) | GO:0009416 response to light stimulus Biological Process GO:0009658 chloroplast organization Biological Process GO:0009661 chromoplast organization Biological Process GO:0009704 de-etiolation Biological Process GO:0009826 unidimensional cell growth Biological Process GO:0050821 protein stabilization Biological Process GO:1904143 positive regulation of carotenoid biosynthetic process Biological Process GO:0005634 nucleus Cellular Component GO:0005737 cytoplasm Cellular Component GO:0005739 mitochondrion Cellular Component GO:0009507 chloroplast Cellular Component GO:0031969 chloroplast membrane Cellular Component | |||||||||
| KEGG gene cross-reference | ath:AT5G06130 ath:AT5G61670 cmo:103504703 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene. |
Gene expression
View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.
Data sources and gene correspondence
Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.
Subcellular Localization Top 5
Computational predictions or homology annotations below do not replace localization experiments.
LocPro · Direct prediction · Computational prediction, not experimental localization
Predicted Functional Domains
Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.
PF30755.1Orange_N75-125 aaPF30754.1Orange_mid154-239 aaPF30758.1Orange_C240-316 aa| Gene ID | Domain ID | Domain Name | Start aa | End aa | E-value | Score |
|---|---|---|---|---|---|---|
| LXL04_012093 | PF30755.1 | Orange_N | 75 | 125 | 3e-31 | 107.7 |
| LXL04_012093 | PF30754.1 | Orange_mid | 154 | 239 | 3.8e-47 | 159.1 |
| LXL04_012093 | PF30758.1 | Orange_C | 240 | 316 | 9.7e-36 | 122.7 |
Arabidopsis / Rice Protein Homology
Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.