LXL04_012078 | RubberDandelionOmics

Gene overview

LXL04_012078

Reference: OH-1004 Chr: Chr03 Coordinates: 5994273-5999966 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

2274 bp · LXL04_012078|LXL04_012078|OH1004|cDNA

ATGACCATAGCTTTTGATCCGTCAATCTCATCTGACTACAGACTCGTATACGTATGTGGTTTAGGAAATGTTAATATTACCGGTGAAGGTGAAACGAATTACCAGATCGAAGTTTTCTCCTCGACAACACGCACATGGAAGACTTCATGTCAATTTTCATTTGATAGCAGAATCGATTTGGATTTTAAGCGTGGTGTTTATTGGAACAATGCGATCCATTGGCTTCAAATCGGGGGATATATTTTGTATTTCGATTTGGA...

CDS

Download CDS FASTA

2274 bp · LXL04_012078|LXL04_012078|OH1004|CDS

ATGACCATAGCTTTTGATCCGTCAATCTCATCTGACTACAGACTCGTATACGTATGTGGTTTAGGAAATGTTAATATTACCGGTGAAGGTGAAACGAATTACCAGATCGAAGTTTTCTCCTCGACAACACGCACATGGAAGACTTCATGTCAATTTTCATTTGATAGCAGAATCGATTTGGATTTTAAGCGTGGTGTTTATTGGAACAATGCGATCCATTGGCTTCAAATCGGGGGATATATTTTGTATTTCGATTTGGA...

Protein

Download Protein FASTA

757 aa · LXL04_012078|LXL04_012078|OH1004|PROTEIN

MTIAFDPSISSDYRLVYVCGLGNVNITGEGETNYQIEVFSSTTRTWKTSCQFSFDSRIDLDFKRGVYWNNAIHWLQIGGYILYFDLDEEIIHKKQTPLKLLGLDADSNRIFESRDRLLLVELELVSLNSKFKIHELKRDYSEWSVKYLVDIEEVGGLFPEIMNPRLATKFQFDIQSLVLGEKEGDCFLVLEIIGKALRYNLVTKTFHKLNDFPASRFPKYYRLFTGMPYVFPFVDLFPLFSLKVSADILHPKPDDAGDSF...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_012078`
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_012078

Location Chr03:5994273-5999966 (-)

Description Similar to At5g07610: F-box protein At5g07610

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At5g07610`	F-box protein At5g07610.	No verified direct reference in this release
`At3g10430`	Putative F-box protein At3g10430.	No verified direct reference in this release
`At3g08750`	F-box protein At3g08750.	No verified direct reference in this release
`At4g19940`	F-box protein At4g19940.	No verified direct reference in this release
`At3g22730`	Putative F-box/kelch-repeat protein At3g22730.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_012078 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0005634 nucleus Cellular Component

GO:0005739 mitochondrion Cellular Component

GO:0009507 chloroplast Cellular Component

KEGG gene cross-reference

ath:AT3G08750

ath:AT3G10430

ath:AT4G19940

ath:AT5G07610

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.676

Rank 1 · LXL04_012078 · OH-1004

Nucleus0.397

Rank 2 · LXL04_012078 · OH-1004

Cell membrane0.095

Rank 3 · LXL04_012078 · OH-1004

Endoplasmic reticulum0.075

Rank 4 · LXL04_012078 · OH-1004

Lysosome / Vacuole0.035

Rank 5 · LXL04_012078 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00646.39F-box375-410 aa

PF07734.19FBA_1461-616 aa

PF03478.25Beta-prop_KIB1-4482-661 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_012078	`PF00646.39`	F-box	375	410	1.1e-06	29.0
LXL04_012078	`PF07734.19`	FBA_1	461	616	2.7e-09	37.2
LXL04_012078	`PF03478.25`	Beta-prop_KIB1-4	482	661	5.7e-09	36.6

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9FLS0`	Arabidopsis thaliana	F-box protein At5g07610	30.612%	Swiss-Prot	weak database homology
`Q9CAE7`	Arabidopsis thaliana	Putative F-box protein At3g10430	26.749%	Swiss-Prot	weak database homology
`Q9C9Y4`	Arabidopsis thaliana	F-box protein At3g08750	25.207%	Swiss-Prot	weak database homology
`O49421`	Arabidopsis thaliana	F-box protein At4g19940	27.064%	Swiss-Prot	weak database homology
`Q9LUI8`	Arabidopsis thaliana	Putative F-box/kelch-repeat protein At3g22730	22.118%	Swiss-Prot	weak database homology

JBrowse

View in Genome Browser

Gene Card