LXL04_012015 | RubberDandelionOmics

Gene overview

LXL04_012015

Reference: OH-1004 Chr: Chr03 Coordinates: 4815637-4820025 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

447 bp · LXL04_012015|LXL04_012015|OH1004|cDNA

ATGGGGAAAGATCTGAGCGACGATCAAGTTTCTTCTATGAAAGAAGCCTTTACGCTTTTTGACACCGACGGCGACGGAAAGATTGCACCATCGGAGCTCGGAATCCTTATGCGTTCCCTCGGCGGAAACCCTACCCAAGCTCAACTAAAGACTATAATCGCTGAAGAAAAACTCACATCTCCCTTCGATTTCAAACGTTTCCTTGAGTTAATGTCGAAACATCTCAAACCTGAGCCCTTCGATCGCCAGCTCCGTGATGC...

CDS

Download CDS FASTA

447 bp · LXL04_012015|LXL04_012015|OH1004|CDS

ATGGGGAAAGATCTGAGCGACGATCAAGTTTCTTCTATGAAAGAAGCCTTTACGCTTTTTGACACCGACGGCGACGGAAAGATTGCACCATCGGAGCTCGGAATCCTTATGCGTTCCCTCGGCGGAAACCCTACCCAAGCTCAACTAAAGACTATAATCGCTGAAGAAAAACTCACATCTCCCTTCGATTTCAAACGTTTCCTTGAGTTAATGTCGAAACATCTCAAACCTGAGCCCTTCGATCGCCAGCTCCGTGATGC...

Protein

Download Protein FASTA

148 aa · LXL04_012015|LXL04_012015|OH1004|PROTEIN

MGKDLSDDQVSSMKEAFTLFDTDGDGKIAPSELGILMRSLGGNPTQAQLKTIIAEEKLTSPFDFKRFLELMSKHLKPEPFDRQLRDAFKVIDKDATGYVVVADLKHILTSIGEKLEPAEFDEWIREVDVGSDGKIKESGCAKSARQTC

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_012015`
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_012015

Location Chr03:4815637-4820025 (+)

Description Similar to CML13: Probable calcium-binding protein CML13

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At1g12310`	Potential calcium sensor.	No verified direct reference in this release
`At1g62820`	Potential calcium sensor.	No verified direct reference in this release
`At5g21274`	Calmodulin mediates the control of a large number of enzymes, ion channels and other proteins by Ca(2+).	No verified direct reference in this release

Rice

Reference gene ID	Possible function	Papers / DOI
`Os08g0117400`	Potential calcium sensor.	No verified direct reference in this release

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_012015 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0019722 calcium-mediated signaling Biological Process

GO:0071548 response to dexamethasone Biological Process

GO:0005576 extracellular region Cellular Component

GO:0005634 nucleus Cellular Component

GO:0005737 cytoplasm Cellular Component

GO:0005829 cytosol Cellular Component

GO:0005886 plasma membrane Cellular Component

GO:0009536 plastid Cellular Component

GO:0016460 myosin II complex Cellular Component

GO:0005509 calcium ion binding Molecular Function

GO:0030234 enzyme regulator activity Molecular Function

KEGG gene cross-reference

ath:AT1G12310

ath:AT1G62820

ath:AT5G21274

dosa:Os08g0117400

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.682

Rank 1 · LXL04_012015 · OH-1004

Nucleus0.239

Rank 2 · LXL04_012015 · OH-1004

Cell membrane0.096

Rank 3 · LXL04_012015 · OH-1004

Endoplasmic reticulum0.084

Rank 4 · LXL04_012015 · OH-1004

Mitochondrion0.065

Rank 5 · LXL04_012015 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF13499.13EF-hand_712-55 aa

PF13405.13EF-hand_613-41 aa

PF00036.39EF-hand_113-40 aa

PF13202.13EF-hand_514-35 aa

PF30551.1CFAP251_C25-127 aa

PF13499.13EF-hand_782-135 aa

PF13405.13EF-hand_683-112 aa

PF14658.13EF-hand_987-131 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_012015	`PF13499.13`	EF-hand_7	12	55	5.1e-21	75.5
LXL04_012015	`PF13405.13`	EF-hand_6	13	41	1.5e-16	59.2
LXL04_012015	`PF00036.39`	EF-hand_1	13	40	1.5e-13	49.9
LXL04_012015	`PF13202.13`	EF-hand_5	14	35	9.8e-08	31.9
LXL04_012015	`PF30551.1`	CFAP251_C	25	127	1e-06	29.2
LXL04_012015	`PF13499.13`	EF-hand_7	82	135	5.1e-21	75.5
LXL04_012015	`PF13405.13`	EF-hand_6	83	112	1.5e-16	59.2
LXL04_012015	`PF14658.13`	EF-hand_9	87	131	3.2e-08	34.6

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q94AZ4`	Arabidopsis thaliana	Probable calcium-binding protein CML13	86.131%	Swiss-Prot	strong database homology
`Q8VZ50`	Arabidopsis thaliana	Probable calcium-binding protein CML14	81.752%	Swiss-Prot	strong database homology
`Q03509`	Arabidopsis thaliana	Calmodulin-6	48.551%	Swiss-Prot	moderate database homology
`Q84VG0`	Oryza sativa subsp. japonica	Probable calcium-binding protein CML7	77.037%	Swiss-Prot	strong database homology

JBrowse

View in Genome Browser

Gene Card