LXL04_012014 | RubberDandelionOmics

Gene overview

LXL04_012014

Reference: OH-1004 Chr: Chr03 Coordinates: 4811069-4812065 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

660 bp · LXL04_012014|LXL04_012014|OH1004|cDNA

ATGAAGCTTGAATTTTCTGATTGGAATAGGCATGGGAAACAGTCGTGTGGTGTTTGTCGGTACCCAATTATTGGGTCTCGATTCAAGGAGATGAAATCAGGGTTTAGTCTTTGTGGTCAATGTTACAGTGAAGGTAAAGTTCCGACGAGTTTTAAATTTGATGAATATCGGTTTAAAGAATATGTGAAAGAAAGTGAAGCCGTGAAAGATAAGTGTATGTGGTTTAGTTTGCAAAAGAGCTCATCGGGTACCGCTACTAA...

CDS

Download CDS FASTA

660 bp · LXL04_012014|LXL04_012014|OH1004|CDS

ATGAAGCTTGAATTTTCTGATTGGAATAGGCATGGGAAACAGTCGTGTGGTGTTTGTCGGTACCCAATTATTGGGTCTCGATTCAAGGAGATGAAATCAGGGTTTAGTCTTTGTGGTCAATGTTACAGTGAAGGTAAAGTTCCGACGAGTTTTAAATTTGATGAATATCGGTTTAAAGAATATGTGAAAGAAAGTGAAGCCGTGAAAGATAAGTGTATGTGGTTTAGTTTGCAAAAGAGCTCATCGGGTACCGCTACTAA...

Protein

Download Protein FASTA

219 aa · LXL04_012014|LXL04_012014|OH1004|PROTEIN

MKLEFSDWNRHGKQSCGVCRYPIIGSRFKEMKSGFSLCGQCYSEGKVPTSFKFDEYRFKEYVKESEAVKDKCMWFSLQKSSSGTATNIQDLPPEKENRGEYNGDNVRLPTGDTTPLTVSGYFKDGGGGRRSSGTGSRRRGTGRRPSLDADDFINLVHGSDLVKVELNRLENEVRDKDRELSESQAEIKELRLSERLREKAVEEVLFSELCVFSNFVLLY

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_012014`
TK1151 ID	TkA06G420080
OH-1004 ID	LXL04_012014
Relationship / confidence	Non Reciprocal Best Hit / Complex relationship
Protein identity (%)	90.000
Protein coverage (%)	TK1151 100.000 / OH-1004 47.945 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_012014

Location Chr03:4811069-4812065 (+)

Description Similar to At1g05150: Uncharacterized TPR repeat-containing protein At1g05150

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At1g05150`	Uncharacterized TPR repeat-containing protein At1g05150.	No verified direct reference in this release
`At2g32450`	Uncharacterized TPR repeat-containing protein At2g32450.	No verified direct reference in this release
`At1g14840`	Plant-specific protein that interact with microtubules.	No verified direct reference in this release
`At1g68060`	Plant-specific protein that interact with microtubules.	No verified direct reference in this release
`At2g01750`	Plant-specific protein that interact with microtubules.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_012014 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0007010 cytoskeleton organization Biological Process

GO:0009832 plant-type cell wall biogenesis Biological Process

GO:0010051 xylem and phloem pattern formation Biological Process

GO:0071555 cell wall organization Biological Process

GO:0005576 extracellular region Cellular Component

GO:0005634 nucleus Cellular Component

GO:0005737 cytoplasm Cellular Component

GO:0005768 endosome Cellular Component

GO:0005783 endoplasmic reticulum Cellular Component

GO:0005794 Golgi apparatus Cellular Component

GO:0005802 trans-Golgi network Cellular Component

GO:0005819 spindle Cellular Component

KEGG gene cross-reference

ath:AT1G05150

ath:AT1G14840

ath:AT1G68060

ath:AT2G01750

ath:AT2G32450

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.489

Rank 1 · LXL04_012014 · OH-1004

Cytoplasm0.385

Rank 2 · LXL04_012014 · OH-1004

Cell membrane0.145

Rank 3 · LXL04_012014 · OH-1004

Endoplasmic reticulum0.061

Rank 4 · LXL04_012014 · OH-1004

Golgi apparatus0.048

Rank 5 · LXL04_012014 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF07058.17MAP70150-204 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_012014	`PF07058.17`	MAP70	150	204	6.6e-23	82.0

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`O23052`	Arabidopsis thaliana	Uncharacterized TPR repeat-containing protein At1g05150	62.791%	Swiss-Prot	weak database homology
`Q8S8L9`	Arabidopsis thaliana	Uncharacterized TPR repeat-containing protein At2g32450	63.218%	Swiss-Prot	weak database homology
`Q9LQU7`	Arabidopsis thaliana	Microtubule-associated protein 70-4	66.667%	Swiss-Prot	weak database homology
`Q9C9X0`	Arabidopsis thaliana	Microtubule-associated protein 70-1	54.237%	Swiss-Prot	moderate database homology
`Q9ZUA3`	Arabidopsis thaliana	Microtubule-associated protein 70-3	77.143%	Swiss-Prot	weak database homology

JBrowse

View in Genome Browser

Gene Card