LXL04_012011 | RubberDandelionOmics

Gene overview

LXL04_012011

Reference: OH-1004 Chr: Chr03 Coordinates: 4785111-4787728 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

2112 bp · LXL04_012011|LXL04_012011|OH1004|cDNA

ATGGCTCGTGCTGAAAACCACACTCCGAGCATTACAACAAACAAAATCGTTAGCATCCCAACCATTTATCTTTACCTGAAGGAAACATTCCATAGTAAAGAAAGAGCGAAAATGGGTGTTTCATCGTTTCTTTTGTTGCTCTCTCTGTTCTTCACCATATTGTGTGCACCAACTGTTTGTGGAAACGCAGAGCTTCGAGCCCTGATGGACATCAAGACCAGTCTAGACCCATACAACCTACATTTGGGCTCCTGGACTGT...

CDS

Download CDS FASTA

2112 bp · LXL04_012011|LXL04_012011|OH1004|CDS

ATGGCTCGTGCTGAAAACCACACTCCGAGCATTACAACAAACAAAATCGTTAGCATCCCAACCATTTATCTTTACCTGAAGGAAACATTCCATAGTAAAGAAAGAGCGAAAATGGGTGTTTCATCGTTTCTTTTGTTGCTCTCTCTGTTCTTCACCATATTGTGTGCACCAACTGTTTGTGGAAACGCAGAGCTTCGAGCCCTGATGGACATCAAGACCAGTCTAGACCCATACAACCTACATTTGGGCTCCTGGACTGT...

Protein

Download Protein FASTA

703 aa · LXL04_012011|LXL04_012011|OH1004|PROTEIN

MARAENHTPSITTNKIVSIPTIYLYLKETFHSKERAKMGVSSFLLLLSLFFTILCAPTVCGNAELRALMDIKTSLDPYNLHLGSWTVLGNHCDFEGVGCNEMGQVANISLQGKGLSGKLSPAFSELKHLTGLYLHYNSLSGDFPKEIANLTELSDLYLNVNNLSGSIPVELENMESLQVLQLCYNQFSGSIPTQLGSLKKLTVLSLQFNHLSGALPASLGDLALLTRLDLSFNRLFGSIPTRLADAPMLQVLDVRNNTLS...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_012011`
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_012011

Location Chr03:4785111-4787728 (-)

Description Similar to NIK2: Protein NSP-INTERACTING KINASE 2

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At4g20140`	Together with GSO2, receptor-like serine/threonine-kinase required during the development of the epidermal surface in embryos and cotyledons.	GASSHO1 and GASSHO2 encoding a putative leucine-rich repeat transmembrane-type receptor kinase are essential for the normal development of the epidermal surface in Arabidopsis embryos.2008 · DOI: 10.1111/j.1365-313x.2007.03395.x The receptor-like kinases GSO1 and GSO2 together regulate root growth in Arabidopsis through control of cell division and cell fate specification.2014 · DOI: 10.1002/dvdy.24066 A peptide hormone required for Casparian strip diffusion barrier formation in Arabidopsis roots.2017 · DOI: 10.1126/science.aai9057
`At5g44700`	Together with GSO1, receptor-like serine/threonine-kinase required during the development of the epidermal surface in embryos and cotyledons.	GASSHO1 and GASSHO2 encoding a putative leucine-rich repeat transmembrane-type receptor kinase are essential for the normal development of the epidermal surface in Arabidopsis embryos.2008 · DOI: 10.1111/j.1365-313x.2007.03395.x The receptor-like kinases GSO1 and GSO2 together regulate root growth in Arabidopsis through control of cell division and cell fate specification.2014 · DOI: 10.1002/dvdy.24066 A peptide hormone required for Casparian strip diffusion barrier formation in Arabidopsis roots.2017 · DOI: 10.1126/science.aai9057
`At3g25560`	Receptor kinase acting, redundantly with other CIKs (e.g. CIK1, CIK2, CIK3, CIK5 and CIK6), as a coreceptor of CLV1, CLV2/CRN and RPK2, and required for CLAVATA-family peptides (e.g. CLV3, CLE25, CLE26 and CLE45) signaling through phosphorylation; this signaling regulates protophloem differentiation and the maintenance of shoot apical meristem (SAM) and root apical meristem (RAM) homeostasis, and acts down-stream of BRX and OPS.	No verified direct reference in this release
`At5g16000`	May act as a receptor kinase regulating meristem homeostasis and protophloem differentiation.	Regulated nuclear trafficking of rpL10A mediated by NIK1 represents a defense strategy of plant cells against virus.2008 · DOI: 10.1371/journal.ppat.1000247 NIK1-mediated translation suppression functions as a plant antiviral immunity mechanism.2015 · DOI: 10.1038/nature14171 CLERK is a novel receptor kinase required for sensing of root-active CLE peptides in Arabidopsis .2018 · DOI: 10.1242/dev.162354

Rice

Reference gene ID	Possible function	Papers / DOI
`Os02g0283800`	May be involved in the regulation of plant growth through the brassinosteroid (BR) signaling pathway.	No verified direct reference in this release

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_012011 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0006952 defense response Biological Process

GO:0007165 signal transduction Biological Process

GO:0009611 response to wounding Biological Process

GO:0009742 brassinosteroid mediated signaling pathway Biological Process

GO:0035556 intracellular signal transduction Biological Process

GO:0042659 regulation of cell fate specification Biological Process

GO:0045184 establishment of protein localization Biological Process

GO:0048638 regulation of developmental growth Biological Process

GO:0051302 regulation of cell division Biological Process

GO:0055075 potassium ion homeostasis Biological Process

GO:0090708 specification of plant organ axis polarity Biological Process

GO:0160073 Casparian strip assembly Biological Process

KEGG gene cross-reference

ath:AT3G25560

ath:AT4G20140

dosa:Os02g0283800

osa:4329032

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cell membrane0.846

Rank 1 · LXL04_012011 · OH-1004

Cytoplasm0.080

Rank 2 · LXL04_012011 · OH-1004

Endoplasmic reticulum0.080

Rank 3 · LXL04_012011 · OH-1004

Nucleus0.067

Rank 4 · LXL04_012011 · OH-1004

Lysosome / Vacuole0.023

Rank 5 · LXL04_012011 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF08263.18LRRNT_262-100 aa

PF23598.2LRR_14118-256 aa

PF13855.13LRR_8122-163 aa

PF13855.13LRR_8176-235 aa

PF12799.14LRR_4176-211 aa

PF00069.32Pkinase438-696 aa

PF07714.24PK_Tyr_Ser-Thr439-698 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_012011	`PF08263.18`	LRRNT_2	62	100	2.4e-06	28.4
LXL04_012011	`PF23598.2`	LRR_14	118	256	1.1e-09	38.3
LXL04_012011	`PF13855.13`	LRR_8	122	163	2.6e-14	53.4
LXL04_012011	`PF13855.13`	LRR_8	176	235	2.6e-14	53.4
LXL04_012011	`PF12799.14`	LRR_4	176	211	2e-10	41.3
LXL04_012011	`PF00069.32`	Pkinase	438	696	2.4e-27	96.7
LXL04_012011	`PF07714.24`	PK_Tyr_Ser-Thr	439	698	6.8e-40	137.7

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`C0LGQ5`	Arabidopsis thaliana	LRR receptor-like serine/threonine-protein kinase GSO1	30.064%	Swiss-Prot	moderate database homology
`Q9FIZ3`	Arabidopsis thaliana	LRR receptor-like serine/threonine-protein kinase GSO2	29.665%	Swiss-Prot	weak database homology
`Q8RY65`	Arabidopsis thaliana	Protein CLAVATA3 INSENSITIVE RECEPTOR KINASE 6	28.111%	Swiss-Prot	weak database homology
`Q9LFS4`	Arabidopsis thaliana	Protein CLAVATA3 INSENSITIVE RECEPTOR KINASE 5	29.694%	Swiss-Prot	weak database homology
`Q6K4T4`	Oryza sativa subsp. japonica	LRR receptor kinase SERK2	28.043%	Swiss-Prot	weak database homology

JBrowse

View in Genome Browser

Gene Card