LXL04_012000 | RubberDandelionOmics

Gene overview

LXL04_012000

Reference: OH-1004 Chr: Chr03 Coordinates: 4555463-4556115 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

336 bp · LXL04_012000|LXL04_012000|OH1004|cDNA

ATGGCGAGCATTGTCGGGGTTGGGATTCCTTTCGGCATATCATCACCACCGCAGGCACTCAAACCATCCACCAGAGTCGGCGGAGTTGCGACACAATTCAACCACTCCACGCAGCGGATGGTGGCGGTAAAAGCAGAGGCTGGTGGTATAAACCCTGAAATCAGGAAAACCGAAGACAAAGTTGTCGATTCTGTCGTTGTTACAGAACTCGCCAAGCCTGTCACTCCTTATTGCAGGTGTTGGAGATCTGGGACTTTCCC...

CDS

Download CDS FASTA

336 bp · LXL04_012000|LXL04_012000|OH1004|CDS

ATGGCGAGCATTGTCGGGGTTGGGATTCCTTTCGGCATATCATCACCACCGCAGGCACTCAAACCATCCACCAGAGTCGGCGGAGTTGCGACACAATTCAACCACTCCACGCAGCGGATGGTGGCGGTAAAAGCAGAGGCTGGTGGTATAAACCCTGAAATCAGGAAAACCGAAGACAAAGTTGTCGATTCTGTCGTTGTTACAGAACTCGCCAAGCCTGTCACTCCTTATTGCAGGTGTTGGAGATCTGGGACTTTCCC...

Protein

Download Protein FASTA

111 aa · LXL04_012000|LXL04_012000|OH1004|PROTEIN

MASIVGVGIPFGISSPPQALKPSTRVGGVATQFNHSTQRMVAVKAEAGGINPEIRKTEDKVVDSVVVTELAKPVTPYCRCWRSGTFPLCDGSHVKHNKATGDNVGPLLLKK

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_012000`
TK1151 ID	TkA02G594040
OH-1004 ID	LXL04_012000
Relationship / confidence	Rbh High Identity Coverage Synteny / Strict
Protein identity (%)	100.000
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_012000

Location Chr03:4555463-4556115 (-)

Description Similar to NEET: CDGSH iron-sulfur domain-containing protein NEET

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At5g51720`	Plays an important role in plant development, senescence, reactive oxygen homeostasis, and iron metabolism.	Characterization of Arabidopsis NEET reveals an ancient role for NEET proteins in iron metabolism.2012 · DOI: 10.1105/tpc.112.097634

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_012000 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0000422 autophagy of mitochondrion Biological Process

GO:0006879 intracellular iron ion homeostasis Biological Process

GO:0010150 leaf senescence Biological Process

GO:0010506 regulation of autophagy Biological Process

GO:0060586 multicellular organismal-level iron ion homeostasis Biological Process

GO:0072593 reactive oxygen species metabolic process Biological Process

GO:0005739 mitochondrion Cellular Component

GO:0005741 mitochondrial outer membrane Cellular Component

GO:0005789 endoplasmic reticulum membrane Cellular Component

GO:0005829 cytosol Cellular Component

GO:0009507 chloroplast Cellular Component

GO:0009536 plastid Cellular Component

KEGG gene cross-reference

ath:AT5G51720

dre:393354

sasa:106602754

xla:398808

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Plastid0.978

Rank 1 · LXL04_012000 · OH-1004

Mitochondrion0.029

Rank 2 · LXL04_012000 · OH-1004

Nucleus0.014

Rank 3 · LXL04_012000 · OH-1004

Cytoplasm0.011

Rank 4 · LXL04_012000 · OH-1004

Cell membrane0.009

Rank 5 · LXL04_012000 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF09360.16zf-CDGSH70-93 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_012000	`PF09360.16`	zf-CDGSH	70	93	4.3e-09	37.2

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9FLI7`	Arabidopsis thaliana	CDGSH iron-sulfur domain-containing protein NEET	67.857%	Swiss-Prot	strong database homology

JBrowse

View in Genome Browser

Gene Card