LXL04_011986 | RubberDandelionOmics

Gene overview

LXL04_011986

Reference: OH-1004 Chr: Chr03 Coordinates: 4172361-4173440 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

798 bp · LXL04_011986|LXL04_011986|OH1004|cDNA

ATGTTCTCTTTCCAGCAAAGTGATGAGCTGGTATTTCATGAGATTCCTTGTAATTCGATTTCCTTCAAACAACCGCCACCAAATCAAGAAGATCTTATAGTGGAGCTTCACGATCATGTTAACATGGACGGCAATTCAAATATTTCAGTCAGCAATAAGGCGAGAAAACGGCACGGAAATATTCAGTCTCCTTCGTCTAAACCTAATTCCGCTACTACTAATCATGATCATGGGGGAGGAGATTCTAGTAAAGATGAACT...

CDS

Download CDS FASTA

798 bp · LXL04_011986|LXL04_011986|OH1004|CDS

ATGTTCTCTTTCCAGCAAAGTGATGAGCTGGTATTTCATGAGATTCCTTGTAATTCGATTTCCTTCAAACAACCGCCACCAAATCAAGAAGATCTTATAGTGGAGCTTCACGATCATGTTAACATGGACGGCAATTCAAATATTTCAGTCAGCAATAAGGCGAGAAAACGGCACGGAAATATTCAGTCTCCTTCGTCTAAACCTAATTCCGCTACTACTAATCATGATCATGGGGGAGGAGATTCTAGTAAAGATGAACT...

Protein

Download Protein FASTA

265 aa · LXL04_011986|LXL04_011986|OH1004|PROTEIN

MFSFQQSDELVFHEIPCNSISFKQPPPNQEDLIVELHDHVNMDGNSNISVSNKARKRHGNIQSPSSKPNSATTNHDHGGGDSSKDELTNRKLLHREIERQRRQDMAKLYASLRGLLPLEFVKGKRSTSDHMFEAVNYIKHMQENINVLSFKRDRLKKDVETGVSLGSPVINSNEKRLMNPVPNTVSISSCKGGIQIMINSCSVEGGFPLSRVLQAISEEGLNIITCNSTKVNERLFHSIQSEANEQVMMDLSVLQQRLTA...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_011986`
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_011986

Location Chr03:4172361-4173440 (-)

Description Similar to BHLH36: Transcription factor bHLH36

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At5g51780`	Transcription factor bHLH36.	No verified direct reference in this release
`At5g51790`	Transcription factor bHLH120.	No verified direct reference in this release
`At4g25400`	Transcription factor bHLH118.	No verified direct reference in this release
`At4g25410`	Transcription factor bHLH126.	No verified direct reference in this release
`At1g12540`	Transcription factor bHLH55.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_011986 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0006351 DNA-templated transcription Biological Process

GO:0006355 regulation of DNA-templated transcription Biological Process

GO:0006357 regulation of transcription by RNA polymerase II Biological Process

GO:0005634 nucleus Cellular Component

GO:0090575 RNA polymerase II transcription regulator complex Cellular Component

GO:0000977 RNA polymerase II transcription regulatory region sequence-specific DNA binding Molecular Function

GO:0000981 DNA-binding transcription factor activity, RNA polymerase II-specific Molecular Function

GO:0003700 DNA-binding transcription factor activity Molecular Function

GO:0046983 protein dimerization activity Molecular Function

KEGG gene cross-reference

ath:AT1G12540

ath:AT4G25410

ath:AT5G51780

ath:AT5G51790

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.964

Rank 1 · LXL04_011986 · OH-1004

Cytoplasm0.114

Rank 2 · LXL04_011986 · OH-1004

Cell membrane0.023

Rank 3 · LXL04_011986 · OH-1004

Endoplasmic reticulum0.018

Rank 4 · LXL04_011986 · OH-1004

Plastid0.010

Rank 5 · LXL04_011986 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00010.32HLH90-142 aa

PF22754.5bHLH-TF_ACT-like_plant187-259 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_011986	`PF00010.32`	HLH	90	142	2.4e-12	47.2
LXL04_011986	`PF22754.5`	bHLH-TF_ACT-like_plant	187	259	9.8e-06	26.3

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9FLI1`	Arabidopsis thaliana	Transcription factor bHLH36	48.276%	Swiss-Prot	moderate database homology
`Q9FLI0`	Arabidopsis thaliana	Transcription factor bHLH120	40.609%	Swiss-Prot	moderate database homology
`Q9STJ7`	Arabidopsis thaliana	Transcription factor bHLH118	43.275%	Swiss-Prot	moderate database homology
`Q9STJ6`	Arabidopsis thaliana	Transcription factor bHLH126	41.566%	Swiss-Prot	moderate database homology
`Q9LN95`	Arabidopsis thaliana	Transcription factor bHLH55	37.705%	Swiss-Prot	moderate database homology

JBrowse

View in Genome Browser

Gene Card