LXL04_011929 | RubberDandelionOmics

Gene overview

LXL04_011929

Reference: OH-1004 Chr: Chr03 Coordinates: 2941063-2944100 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1941 bp · LXL04_011929|LXL04_011929|OH1004|cDNA

ATGGCGGGACAACATACTCCGTACTACACCCCCACCACCAAACCCAACGCCGCCGCCGCCGCCTCCGCCCATCTCCTCCGTAAAAATAACGTTTTATTAGCTTGTCTTGTCTTCTTCCTCTGTTCTTTCTTTTACTTATTCGGTTCATGGCAAACCCATGTCCCCTCCTCTTCCACTGCCACCTCCCTCCGCACCACCACCGTCAACTGCGACGCCACCACATCCAGCTACAACTCAACCGTCGTAGCTGACAAATACAA...

CDS

Download CDS FASTA

1941 bp · LXL04_011929|LXL04_011929|OH1004|CDS

ATGGCGGGACAACATACTCCGTACTACACCCCCACCACCAAACCCAACGCCGCCGCCGCCGCCTCCGCCCATCTCCTCCGTAAAAATAACGTTTTATTAGCTTGTCTTGTCTTCTTCCTCTGTTCTTTCTTTTACTTATTCGGTTCATGGCAAACCCATGTCCCCTCCTCTTCCACTGCCACCTCCCTCCGCACCACCACCGTCAACTGCGACGCCACCACATCCAGCTACAACTCAACCGTCGTAGCTGACAAATACAA...

Protein

Download Protein FASTA

646 aa · LXL04_011929|LXL04_011929|OH1004|PROTEIN

MAGQHTPYYTPTTKPNAAAAASAHLLRKNNVLLACLVFFLCSFFYLFGSWQTHVPSSSTATSLRTTTVNCDATTSSYNSTVVADKYKDLDFTAHHSATADDSITVKTYPPCSVKYSEYTPCTDQKRSLKFSRDRLIYRERHCPEKNELLKCRIPAPFGYKNPFKWPMSRDLAWYANVPHKDLTVEKAVQNWIRFEGDRFRFPGGGTMFPNGADAYIDDIGKLINLNDGSIRTAIDTGCGVASWGAYLLSRNIIAMSFAPR...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_011929`
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_011929

Location Chr03:2941063-2944100 (-)

Description Similar to At2g45750: Probable methyltransferase PMT16

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At2g45750`	Probable methyltransferase PMT16.	No verified direct reference in this release
`At4g00750`	Probable methyltransferase PMT15.	No verified direct reference in this release
`At4g10440`	Probable methyltransferase PMT17.	No verified direct reference in this release
`At1g33170`	Probable methyltransferase PMT18.	No verified direct reference in this release
`At1g26850`	Probable methyltransferase PMT2.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_011929 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0032259 methylation Biological Process

GO:0000139 Golgi membrane Cellular Component

GO:0005634 nucleus Cellular Component

GO:0005737 cytoplasm Cellular Component

GO:0005768 endosome Cellular Component

GO:0005789 endoplasmic reticulum membrane Cellular Component

GO:0005794 Golgi apparatus Cellular Component

GO:0005797 Golgi medial cisterna Cellular Component

GO:0005802 trans-Golgi network Cellular Component

GO:0005829 cytosol Cellular Component

GO:0008168 methyltransferase activity Molecular Function

KEGG gene cross-reference

ath:AT1G26850

ath:AT1G33170

ath:AT2G45750

ath:AT4G00750

ath:AT4G10440

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Golgi apparatus0.760

Rank 1 · LXL04_011929 · OH-1004

Cell membrane0.074

Rank 2 · LXL04_011929 · OH-1004

Endoplasmic reticulum0.071

Rank 3 · LXL04_011929 · OH-1004

Extracellular0.056

Rank 4 · LXL04_011929 · OH-1004

Cytoplasm0.037

Rank 5 · LXL04_011929 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF03141.23Methyltransf_29117-629 aa

PF13649.13Methyltransf_25234-325 aa

PF08241.19Methyltransf_11235-328 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_011929	`PF03141.23`	Methyltransf_29	117	629	5.7e-227	755.0
LXL04_011929	`PF13649.13`	Methyltransf_25	234	325	2.9e-06	28.6
LXL04_011929	`PF08241.19`	Methyltransf_11	235	328	7e-09	36.9

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`O80844`	Arabidopsis thaliana	Probable methyltransferase PMT16	65.422%	Swiss-Prot	strong database homology
`Q9ZPH9`	Arabidopsis thaliana	Probable methyltransferase PMT15	64.506%	Swiss-Prot	strong database homology
`Q9SZX8`	Arabidopsis thaliana	Probable methyltransferase PMT17	60.912%	Swiss-Prot	strong database homology
`Q9C884`	Arabidopsis thaliana	Probable methyltransferase PMT18	58.411%	Swiss-Prot	strong database homology
`B9DFI7`	Arabidopsis thaliana	Probable methyltransferase PMT2	57.237%	Swiss-Prot	strong database homology

JBrowse

View in Genome Browser

Gene Card