LXL04_011925 | RubberDandelionOmics

Gene overview

LXL04_011925

Reference: OH-1004 Chr: Chr03 Coordinates: 2875090-2876239 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

519 bp · LXL04_011925|LXL04_011925|OH1004|cDNA

ATGTTTCTACGGAGGTTTGCTCGGCCGTCATCATTGATGATGATGGCTAAAGTAAAGGAAACAACAGGGATCGTCGGTCTCGAAGTGGTCCCGAACGCTAGGGAGGTACTAATTGGTCTTTACGATAAAACCCTAAAGGAGATCCAGCGTGTACCTGAAGACGAAGGTTACCGCAAAGCCGTCGAGAGTTTCACGCGCCACCGGCTCACGGTCTGCAAAGAGGAAGAAGATTGGGAAGCTATTGAAAAACGACTCGGTTG...

CDS

Download CDS FASTA

519 bp · LXL04_011925|LXL04_011925|OH1004|CDS

ATGTTTCTACGGAGGTTTGCTCGGCCGTCATCATTGATGATGATGGCTAAAGTAAAGGAAACAACAGGGATCGTCGGTCTCGAAGTGGTCCCGAACGCTAGGGAGGTACTAATTGGTCTTTACGATAAAACCCTAAAGGAGATCCAGCGTGTACCTGAAGACGAAGGTTACCGCAAAGCCGTCGAGAGTTTCACGCGCCACCGGCTCACGGTCTGCAAAGAGGAAGAAGATTGGGAAGCTATTGAAAAACGACTCGGTTG...

Protein

Download Protein FASTA

172 aa · LXL04_011925|LXL04_011925|OH1004|PROTEIN

MFLRRFARPSSLMMMAKVKETTGIVGLEVVPNAREVLIGLYDKTLKEIQRVPEDEGYRKAVESFTRHRLTVCKEEEDWEAIEKRLGCGQVEELIEEAQDELKLIDKMIEWDPWGVPDDYECEAVENDAPVPKHVPLHRPGPLPAEFYKTLEAAMAGQLNRKKDEPAITPPSQ

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_011925`
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_011925

Location Chr03:2875090-2876239 (+)

Description Similar to At5g52840: Probable NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 5, mitochondrial

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At5g52840`	Accessory subunit of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I), that is believed not to be involved in catalysis.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_011925 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0009060 aerobic respiration Biological Process

GO:0009853 photorespiration Biological Process

GO:0022904 respiratory electron transport chain Biological Process

GO:0042776 proton motive force-driven mitochondrial ATP synthesis Biological Process

GO:0005739 mitochondrion Cellular Component

GO:0005743 mitochondrial inner membrane Cellular Component

GO:0009536 plastid Cellular Component

GO:0031966 mitochondrial membrane Cellular Component

GO:0032991 protein-containing complex Cellular Component

GO:0045271 respiratory chain complex I Cellular Component

KEGG gene cross-reference

ath:AT5G52840

bta:327714

ddi:DDB_G0272394

mcf:101865843

mmu:68202

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Mitochondrion0.956

Rank 1 · LXL04_011925 · OH-1004

Nucleus0.058

Rank 2 · LXL04_011925 · OH-1004

Cytoplasm0.052

Rank 3 · LXL04_011925 · OH-1004

Cell membrane0.018

Rank 4 · LXL04_011925 · OH-1004

Extracellular0.009

Rank 5 · LXL04_011925 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF04716.20ETC_C1_NDUFA526-92 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_011925	`PF04716.20`	ETC_C1_NDUFA5	26	92	1.7e-27	95.6

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9FLX7`	Arabidopsis thaliana	Probable NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 5, mitochondrial	76.923%	Swiss-Prot	strong database homology

JBrowse

View in Genome Browser

Gene Card