LXL04_011907 | RubberDandelionOmics

Gene overview

LXL04_011907

Reference: OH-1004 Chr: Chr03 Coordinates: 2585179-2588539 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1836 bp · LXL04_011907|LXL04_011907|OH1004|cDNA

ATGGCTCTCTCTTCAAGTAATCTATCTAAATCATGCTCAAACCTGGGGGAAAAAGTACGAGTCATTGCCAGGATTCGAGGTTTTACAGATCAGGAGTTGGCATCTGATGCCACACACTCAAAGTCCATGATATCTGTTTCTAAATCTGGCAAAGGTGGGCCTTTTGAGACAGTTAAGCTTTCATTTGATGATCAAACTTCGAGCCGTAAAAATGAGTATGATGTGGACCATTGTTATCAGCAAAATGAAGATACCGCTGA...

CDS

Download CDS FASTA

1836 bp · LXL04_011907|LXL04_011907|OH1004|CDS

ATGGCTCTCTCTTCAAGTAATCTATCTAAATCATGCTCAAACCTGGGGGAAAAAGTACGAGTCATTGCCAGGATTCGAGGTTTTACAGATCAGGAGTTGGCATCTGATGCCACACACTCAAAGTCCATGATATCTGTTTCTAAATCTGGCAAAGGTGGGCCTTTTGAGACAGTTAAGCTTTCATTTGATGATCAAACTTCGAGCCGTAAAAATGAGTATGATGTGGACCATTGTTATCAGCAAAATGAAGATACCGCTGA...

Protein

Download Protein FASTA

611 aa · LXL04_011907|LXL04_011907|OH1004|PROTEIN

MALSSSNLSKSCSNLGEKVRVIARIRGFTDQELASDATHSKSMISVSKSGKGGPFETVKLSFDDQTSSRKNEYDVDHCYQQNEDTADIFSREIKPLISRVFDGENSTFIAFGARDSGKTYTIQGSEEHFGLGMLAMDDILKTVEGGKHRVTVSMYEVFQDHIYDMLDPRNPEIQVPVKSLSEFQKLYFSDSISNKPTKKITLELPRKSHKALMINILACDEKGSSKLVGKMNFVDLAGYENARRNTIDGPNISESTRINK...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_011907`
TK1151 ID	TkA02G604860
OH-1004 ID	LXL04_011907
Relationship / confidence	Rbh High Identity Coverage Synteny / Strict
Protein identity (%)	96.300
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_011907

Location Chr03:2585179-2588539 (+)

Description Similar to KIN10C: Kinesin-like protein KIN-10C

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At5g02370`	Kinesin-like protein KIN-10B.	No verified direct reference in this release
`At5g23910`	Kinesin-like protein KIN-10C.	No verified direct reference in this release

Rice

Reference gene ID	Possible function	Papers / DOI
`Os05g0459400`	Kinesin-like protein KIN-10C.	No verified direct reference in this release

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_011907 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0006281 DNA repair Biological Process

GO:0007018 microtubule-based movement Biological Process

GO:0007062 sister chromatid cohesion Biological Process

GO:0007080 mitotic metaphase chromosome alignment Biological Process

GO:0051310 metaphase chromosome alignment Biological Process

GO:0000785 chromatin Cellular Component

GO:0005634 nucleus Cellular Component

GO:0005737 cytoplasm Cellular Component

GO:0005819 spindle Cellular Component

GO:0005871 kinesin complex Cellular Component

GO:0005874 microtubule Cellular Component

GO:0009507 chloroplast Cellular Component

KEGG gene cross-reference

ath:AT5G23910

dosa:Os05g0459400

rno:293502

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.546

Rank 1 · LXL04_011907 · OH-1004

Cytoplasm0.438

Rank 2 · LXL04_011907 · OH-1004

Cell membrane0.046

Rank 3 · LXL04_011907 · OH-1004

Mitochondrion0.035

Rank 4 · LXL04_011907 · OH-1004

Endoplasmic reticulum0.022

Rank 5 · LXL04_011907 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF16796.12Microtub_bd18-166 aa

PF00225.30Kinesin24-327 aa

PF12836.14HHH_3549-596 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_011907	`PF16796.12`	Microtub_bd	18	166	2.8e-12	47.5
LXL04_011907	`PF00225.30`	Kinesin	24	327	2.1e-56	192.0
LXL04_011907	`PF12836.14`	HHH_3	549	596	8.4e-06	26.5

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q5E913`	Arabidopsis thaliana	Kinesin-like protein KIN-10B	31.918%	Swiss-Prot	moderate database homology
`F4KEC6`	Arabidopsis thaliana	Kinesin-like protein KIN-10C	40.885%	Swiss-Prot	moderate database homology
`Q6L512`	Oryza sativa subsp. japonica	Kinesin-like protein KIN-10C	33.075%	Swiss-Prot	moderate database homology

JBrowse

View in Genome Browser

Gene Card