LXL04_011727 | RubberDandelionOmics

Gene overview

LXL04_011727

Reference: OH-1004 Chr: Chr02 Coordinates: 170345518-170352457 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

2886 bp · LXL04_011727|LXL04_011727|OH1004|cDNA

ATGGGAGGTTCTGAAGATGATATGGCGTCGTCGGCACGGAAAGGAGGTGGGAGATACGACCCAGCCCATGATAATGCTCCCGTCGTCCTGGAGATGTCCTCCATTGATCCTGGATCTTCATCTTCTTTGAAGAAAGGGAAAGCAGGGCAGCGAAGCCCTGGTGGAGGTACAAAAGAAGACACAATGCGCAACGGGGGAGAATCTAAGCTCGAGTTATTTGGATTTGATTCTCTTGTAAATACTCTTGGTCTTAAAAGCAT...

CDS

Download CDS FASTA

2886 bp · LXL04_011727|LXL04_011727|OH1004|CDS

ATGGGAGGTTCTGAAGATGATATGGCGTCGTCGGCACGGAAAGGAGGTGGGAGATACGACCCAGCCCATGATAATGCTCCCGTCGTCCTGGAGATGTCCTCCATTGATCCTGGATCTTCATCTTCTTTGAAGAAAGGGAAAGCAGGGCAGCGAAGCCCTGGTGGAGGTACAAAAGAAGACACAATGCGCAACGGGGGAGAATCTAAGCTCGAGTTATTTGGATTTGATTCTCTTGTAAATACTCTTGGTCTTAAAAGCAT...

Protein

Download Protein FASTA

961 aa · LXL04_011727|LXL04_011727|OH1004|PROTEIN

MGGSEDDMASSARKGGGRYDPAHDNAPVVLEMSSIDPGSSSSLKKGKAGQRSPGGGTKEDTMRNGGESKLELFGFDSLVNTLGLKSMTGEQVQVTSSPKQVDDAKHPKLPKTGNKNKLGTLMGVFIPCLQNILGIIYYIRFSWIVGIAGIGQSLLLVSLCALCTFLTSISLSAIATNGAMKGGGPYYLIGRALGPEVGVSIGLCFFLGTAVAGAMYVLGAVETFLGAVPKASIFKDTITQTDGVGVAGAPNIHDLQVYGI...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_011727`
TK1151 ID	TkA03G615000
OH-1004 ID	LXL04_011727
Relationship / confidence	Rbh High Identity Coverage Synteny / Strict
Protein identity (%)	99.900
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_011727

Location Chr02:170345518-170352457 (+)

Description Similar to CCC1: Cation-chloride cotransporter 1

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At1g30450`	Cation/chloride cotransporter that mediates potassium-chloride and sodium-chloride cotransports.	No verified direct reference in this release

Rice

Reference gene ID	Possible function	Papers / DOI
`Os08g0323700`	Probable cation/chloride cotransporter that may mediate potassium-chloride cotransport.	Cloning and functional characterization of a cation-chloride cotransporter gene OsCCC1.2011 · DOI: 10.1007/s11103-011-9744-6
`Os01g0304100`	Probable cation/chloride cotransporter.	No verified direct reference in this release

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_011727 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0006821 chloride transport Biological Process

GO:0006884 cell volume homeostasis Biological Process

GO:0055064 chloride ion homeostasis Biological Process

GO:0055075 potassium ion homeostasis Biological Process

GO:0071805 potassium ion transmembrane transport Biological Process

GO:1902476 chloride transmembrane transport Biological Process

GO:1990573 potassium ion import across plasma membrane Biological Process

GO:0005768 endosome Cellular Component

GO:0005794 Golgi apparatus Cellular Component

GO:0005802 trans-Golgi network Cellular Component

GO:0005886 plasma membrane Cellular Component

GO:0016020 membrane Cellular Component

KEGG gene cross-reference

ath:AT1G30450

dosa:Os01g0304100

dosa:Os08g0323700

mmu:20498

rno:29501

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cell membrane0.702

Rank 1 · LXL04_011727 · OH-1004

Cytoplasm0.175

Rank 2 · LXL04_011727 · OH-1004

Endoplasmic reticulum0.109

Rank 3 · LXL04_011727 · OH-1004

Lysosome / Vacuole0.083

Rank 4 · LXL04_011727 · OH-1004

Golgi apparatus0.078

Rank 5 · LXL04_011727 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00324.28AA_permease123-588 aa

PF13520.13AA_permease_2132-554 aa

PF03522.21SLC12629-750 aa

PF03522.21SLC12760-960 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_011727	`PF00324.28`	AA_permease	123	588	3.3e-49	168.6
LXL04_011727	`PF13520.13`	AA_permease_2	132	554	1.6e-15	57.7
LXL04_011727	`PF03522.21`	SLC12	629	750	3.1e-42	145.8
LXL04_011727	`PF03522.21`	SLC12	760	960	3.1e-42	145.8

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q2UVJ5`	Arabidopsis thaliana	Cation-chloride cotransporter 1	74.562%	Swiss-Prot	strong database homology
`Q6Z0E2`	Oryza sativa subsp. japonica	Cation-chloride cotransporter 1	73.327%	Swiss-Prot	strong database homology
`Q657W3`	Oryza sativa subsp. japonica	Cation-chloride cotransporter 2	70.363%	Swiss-Prot	strong database homology

JBrowse

View in Genome Browser

Gene Card