LXL04_011680 | RubberDandelionOmics

Gene overview

LXL04_011680

Reference: OH-1004 Chr: Chr02 Coordinates: 169284543-169290487 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

2853 bp · LXL04_011680|LXL04_011680|OH1004|cDNA

ATGACGATGAACGGACATGGAAGAAAGCAAACCATCTTGATGTTCCCATGGTTAGGCCATGGCCACATCTCTCCATTCCTAGAACTATCCAAAAAACTAAACACCACAAACCTCTTCGACATCTACCTCTGTTCGACCCCTGTCAATCTCACTTCGATCAAAACTTCACCGGCAATCCAACTCATTGAGCTTCACCTTCCGCCACTACCGGAGCTGCCACCACACCTTCACACCACCAATGGCCTCCCACCTCATCTTAT...

CDS

Download CDS FASTA

2853 bp · LXL04_011680|LXL04_011680|OH1004|CDS

ATGACGATGAACGGACATGGAAGAAAGCAAACCATCTTGATGTTCCCATGGTTAGGCCATGGCCACATCTCTCCATTCCTAGAACTATCCAAAAAACTAAACACCACAAACCTCTTCGACATCTACCTCTGTTCGACCCCTGTCAATCTCACTTCGATCAAAACTTCACCGGCAATCCAACTCATTGAGCTTCACCTTCCGCCACTACCGGAGCTGCCACCACACCTTCACACCACCAATGGCCTCCCACCTCATCTTAT...

Protein

Download Protein FASTA

950 aa · LXL04_011680|LXL04_011680|OH1004|PROTEIN

MTMNGHGRKQTILMFPWLGHGHISPFLELSKKLNTTNLFDIYLCSTPVNLTSIKTSPAIQLIELHLPPLPELPPHLHTTNGLPPHLMPVLKKAFDMASDGFSEILKTLKPDLLIYDIIQPWAPVAASALEIPSVVFITTSIAAMMVHFHLSNRPGIPLPFSTIFYRSYEYAKIVKNSDIKSKDEDFVMKCVDRSSSIVLVKSFKEIEGKYSDYLSVLTEKKIVPVGPLVADPSPEMKQNNVIQWLDTKATRSTVFVSFGS...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_011680`
TK1151 ID	TkA03G610210
OH-1004 ID	LXL04_011680
Relationship / confidence	Rbh Below Probable Coverage Or Synteny Threshold / Review
Protein identity (%)	90.900
Protein coverage (%)	TK1151 96.452 / OH-1004 48.105 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID	`LXL04_011680`
Location	Chr02:169284543-169290487 (-)
Description	Similar to UGT29: UDP-glucosyltransferase 29
Arabidopsis / Rice Reference Genes and Papers	Download references for this gene Arabidopsis No hit for this species in the current source table. Rice No hit for this species in the current source table.
Functional annotation source	View annotation sources Functional annotation source: OH1004 · `LXL04_011680` · GCA_047496595.1_OSU_TarKok_2.0.
GO annotations (OH1004 source)	GO:0002238 response to molecule of fungal origin Biological Process GO:0016114 terpenoid biosynthetic process Biological Process GO:0016135 saponin biosynthetic process Biological Process GO:0046246 terpene biosynthetic process Biological Process GO:0008194 UDP-glycosyltransferase activity Molecular Function
KEGG gene cross-reference	ag:AGR44632 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.805

Rank 1 · LXL04_011680 · OH-1004

Nucleus0.244

Rank 2 · LXL04_011680 · OH-1004

Endoplasmic reticulum0.063

Rank 3 · LXL04_011680 · OH-1004

Cell membrane0.052

Rank 4 · LXL04_011680 · OH-1004

Peroxisome0.043

Rank 5 · LXL04_011680 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF26168.1Glyco_transf_N11-228 aa

PF00201.25UDPGT240-381 aa

PF06722.19EryCIII-like_C320-400 aa

PF26168.1Glyco_transf_N496-708 aa

PF00201.25UDPGT734-862 aa

PF06722.19EryCIII-like_C813-880 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_011680	`PF26168.1`	Glyco_transf_N	11	228	2.3e-14	54.6
LXL04_011680	`PF00201.25`	UDPGT	240	381	2.4e-41	142.8
LXL04_011680	`PF06722.19`	EryCIII-like_C	320	400	3.9e-17	63.3
LXL04_011680	`PF26168.1`	Glyco_transf_N	496	708	2.3e-14	54.6
LXL04_011680	`PF00201.25`	UDPGT	734	862	2.4e-41	142.8
LXL04_011680	`PF06722.19`	EryCIII-like_C	813	880	3.9e-17	63.3

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

No result was found for this query.

JBrowse

View in Genome Browser

Gene Card