LXL04_011649 | RubberDandelionOmics

Gene overview

LXL04_011649

Reference: OH-1004 Chr: Chr02 Coordinates: 168833229-168834377 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

963 bp · LXL04_011649|LXL04_011649|OH1004|cDNA

ATGGTGCTCTCATTCTTGGAGACGCTCAAAACACAGCCTTTATGGCTAAATTTCGTGTTTGCGTTGGGTTTTTTATCTTTCCTCAAGACTTCGACTTCAATCATCAGATGGGTTTATGTTAATTTCCTTAGACCTTCAAAGAATCTCAAGAAATACGGATCATGGGCACTTGTTACTGGCTCCACCGACGGCATTGGTAAAGCTTTTGCATTCGAATTAGCTAAAAAGGGTATTAATTTGATCTTGGTGGGTCGAAACCC...

CDS

Download CDS FASTA

963 bp · LXL04_011649|LXL04_011649|OH1004|CDS

ATGGTGCTCTCATTCTTGGAGACGCTCAAAACACAGCCTTTATGGCTAAATTTCGTGTTTGCGTTGGGTTTTTTATCTTTCCTCAAGACTTCGACTTCAATCATCAGATGGGTTTATGTTAATTTCCTTAGACCTTCAAAGAATCTCAAGAAATACGGATCATGGGCACTTGTTACTGGCTCCACCGACGGCATTGGTAAAGCTTTTGCATTCGAATTAGCTAAAAAGGGTATTAATTTGATCTTGGTGGGTCGAAACCC...

Protein

Download Protein FASTA

320 aa · LXL04_011649|LXL04_011649|OH1004|PROTEIN

MVLSFLETLKTQPLWLNFVFALGFLSFLKTSTSIIRWVYVNFLRPSKNLKKYGSWALVTGSTDGIGKAFAFELAKKGINLILVGRNPSKLEGVSSEIKSKFDKTQIKEVVFDLSGDLFEGIKKITESIDGLDIGILINNAGVSYPYARFFHEVDEELLNNLIKVNVEATTRVTQAVLPGMVKRKRGAIVNIGSGAAIVIPSDPLYAVYAATKAYVDQFSRCLYVEYKNSGIDVQCQVPLYVATKMASIKRSSFFVPSASG...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_011649`
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_011649

Location Chr02:168833229-168834377 (-)

Description Similar to KCR1: Very-long-chain 3-oxoacyl-CoA reductase 1

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At1g67730`	Beta-ketoacyl-coenzyme A reductase required for the elongation of fatty acids precursors of sphingolipids, triacylglycerols, cuticular waxes and suberin.	Functional characterization of the Arabidopsis beta-ketoacyl-coenzyme A reductase candidates of the fatty acid elongase.2009 · DOI: 10.1104/pp.109.137497
`At1g24470`	Probable reductase, but unlike KCR1, has no beta-ketoacyl- coenzyme A reductase activity.	Functional characterization of the Arabidopsis beta-ketoacyl-coenzyme A reductase candidates of the fatty acid elongase.2009 · DOI: 10.1104/pp.109.137497

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_011649 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0006694 steroid biosynthetic process Biological Process

GO:0006702 androgen biosynthetic process Biological Process

GO:0006703 estrogen biosynthetic process Biological Process

GO:0009793 embryo development ending in seed dormancy Biological Process

GO:0019367 fatty acid elongation, saturated fatty acid Biological Process

GO:0030497 fatty acid elongation Biological Process

GO:0035338 long-chain fatty-acyl-CoA biosynthetic process Biological Process

GO:0042761 very long-chain fatty acid biosynthetic process Biological Process

GO:0005739 mitochondrion Cellular Component

GO:0005783 endoplasmic reticulum Cellular Component

GO:0005789 endoplasmic reticulum membrane Cellular Component

GO:0009507 chloroplast Cellular Component

KEGG gene cross-reference

ath:AT1G24470

ath:AT1G67730

cci:CC1G_02019

gga:415703

hsa:51144

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Endoplasmic reticulum0.784

Rank 1 · LXL04_011649 · OH-1004

Cytoplasm0.108

Rank 2 · LXL04_011649 · OH-1004

Mitochondrion0.084

Rank 3 · LXL04_011649 · OH-1004

Nucleus0.076

Rank 4 · LXL04_011649 · OH-1004

Cell membrane0.073

Rank 5 · LXL04_011649 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00106.32adh_short55-247 aa

PF08659.17KR55-220 aa

PF13561.13adh_short_C262-247 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_011649	`PF00106.32`	adh_short	55	247	4.6e-41	141.2
LXL04_011649	`PF08659.17`	KR	55	220	2e-06	28.6
LXL04_011649	`PF13561.13`	adh_short_C2	62	247	9e-23	81.8

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q8L9C4`	Arabidopsis thaliana	Very-long-chain 3-oxoacyl-CoA reductase 1	64.744%	Swiss-Prot	strong database homology
`Q9FYL6`	Arabidopsis thaliana	Very-long-chain 3-oxoacyl-CoA reductase-like protein At1g24470	52.961%	Swiss-Prot	strong database homology

JBrowse

View in Genome Browser

Gene Card