LXL04_011617 | RubberDandelionOmics

Gene overview

LXL04_011617

Reference: OH-1004 Chr: Chr02 Coordinates: 168279329-168282010 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1950 bp · LXL04_011617|LXL04_011617|OH1004|cDNA

ATGATACAGGAATTGTTTCGTGAGGGAGACGAGATTGATTTCGCTGGTAAATTGAAGAAGTTCAGCTACAAAAGAAGACCAGCCATGAAGTTTATGAAACTTGGTTCTCGGCCTGATACTTTTTACAATTCAGACTCTGTAAGATCAGTCTCCTCTGAAGTTTCAAGCGATCTTGTTGTTCAAGTAAATGGAACAAGATATTTGCTTCACAAGTTTCCACTTTTATCCAAGTGCTTGCGGTTACAAAGACTCTGTTCCGA...

CDS

Download CDS FASTA

1950 bp · LXL04_011617|LXL04_011617|OH1004|CDS

ATGATACAGGAATTGTTTCGTGAGGGAGACGAGATTGATTTCGCTGGTAAATTGAAGAAGTTCAGCTACAAAAGAAGACCAGCCATGAAGTTTATGAAACTTGGTTCTCGGCCTGATACTTTTTACAATTCAGACTCTGTAAGATCAGTCTCCTCTGAAGTTTCAAGCGATCTTGTTGTTCAAGTAAATGGAACAAGATATTTGCTTCACAAGTTTCCACTTTTATCCAAGTGCTTGCGGTTACAAAGACTCTGTTCCGA...

Protein

Download Protein FASTA

649 aa · LXL04_011617|LXL04_011617|OH1004|PROTEIN

MIQELFREGDEIDFAGKLKKFSYKRRPAMKFMKLGSRPDTFYNSDSVRSVSSEVSSDLVVQVNGTRYLLHKFPLLSKCLRLQRLCSESPDSSSQHQVIQLPDFPGGTESFELCAKFCYGITITLSAYNIVAARCASEYLQMTEDVEKGNLVYKLDVFLNSCILNGWKDSIITLQSTKPFHLWSEDLGITSRCIEAIASKVLSNPLKVSLSHSYSRRGRDRDDISCNGGGESHRNGKSGGKGWWAEDLSELGIDLYWRTMI...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_011617`
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_011617

Location Chr02:168279329-168282010 (-)

Description Similar to At1g67900: BTB/POZ domain-containing protein At1g67900

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At1g67900`	May act as a substrate-specific adapter of an E3 ubiquitin-protein ligase complex (CUL3-RBX1-BTB) which mediates the ubiquitination and subsequent proteasomal degradation of target proteins.	No verified direct reference in this release
`At3g26490`	May act as a substrate-specific adapter of an E3 ubiquitin-protein ligase complex (CUL3-RBX1-BTB) which mediates the ubiquitination and subsequent proteasomal degradation of target proteins.	No verified direct reference in this release
`At2g14820`	May act as a substrate-specific adapter of an E3 ubiquitin-protein ligase complex (CUL3-RBX1-BTB) which mediates the ubiquitination and subsequent proteasomal degradation of target proteins (By similarity).	NPY genes play an essential role in root gravitropic responses in Arabidopsis.2011 · DOI: 10.1093/mp/ssq052 Polar-localized NPH3-like proteins regulate polarity and endocytosis of PIN-FORMED auxin efflux carriers.2011 · DOI: 10.1242/dev.057745
`At5g47800`	May act as a substrate-specific adapter of an E3 ubiquitin-protein ligase complex (CUL3-RBX1-BTB) which mediates the ubiquitination and subsequent proteasomal degradation of target proteins.	No verified direct reference in this release
`At4g37590`	May act as a substrate-specific adapter of an E3 ubiquitin-protein ligase complex (CUL3-RBX1-BTB) which mediates the ubiquitination and subsequent proteasomal degradation of target proteins (By similarity).	NPY genes and AGC kinases define two key steps in auxin-mediated organogenesis in Arabidopsis.2008 · DOI: 10.1073/pnas.0809761106 NPY genes play an essential role in root gravitropic responses in Arabidopsis.2011 · DOI: 10.1093/mp/ssq052

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_011617 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0009908 flower development Biological Process

GO:0009911 positive regulation of flower development Biological Process

GO:0009958 positive gravitropism Biological Process

GO:0016567 protein ubiquitination Biological Process

GO:0071365 cellular response to auxin stimulus Biological Process

GO:1901703 protein localization involved in auxin polar transport Biological Process

GO:2000012 regulation of auxin polar transport Biological Process

GO:0005634 nucleus Cellular Component

GO:0005737 cytoplasm Cellular Component

GO:0005829 cytosol Cellular Component

GO:0005886 plasma membrane Cellular Component

GO:0016324 apical plasma membrane Cellular Component

KEGG gene cross-reference

ath:AT1G67900

ath:AT2G14820

ath:AT3G26490

ath:AT4G37590

ath:AT5G47800

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.572

Rank 1 · LXL04_011617 · OH-1004

Cytoplasm0.288

Rank 2 · LXL04_011617 · OH-1004

Cell membrane0.174

Rank 3 · LXL04_011617 · OH-1004

Endoplasmic reticulum0.047

Rank 4 · LXL04_011617 · OH-1004

Plastid0.037

Rank 5 · LXL04_011617 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF03000.20NPH3242-514 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_011617	`PF03000.20`	NPH3	242	514	3.7e-92	309.3

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9C9V6`	Arabidopsis thaliana	BTB/POZ domain-containing protein At1g67900	68.585%	Swiss-Prot	strong database homology
`Q9LIM6`	Arabidopsis thaliana	BTB/POZ domain-containing protein At3g26490	49.765%	Swiss-Prot	moderate database homology
`O80970`	Arabidopsis thaliana	Phototropic-responsive NPH3 family protein NPY2	43.772%	Swiss-Prot	moderate database homology
`Q9FIK1`	Arabidopsis thaliana	BTB/POZ domain-containing protein At5g47800	43.080%	Swiss-Prot	moderate database homology
`Q0WL52`	Arabidopsis thaliana	Phototropic-responsive NPH3 family protein NPY5	41.534%	Swiss-Prot	moderate database homology

JBrowse

View in Genome Browser

Gene Card