Gene Card
Gene overview
cDNA / CDS / Protein Sequences
729 bp · LXL04_011609|LXL04_011609|OH1004|cDNA
ATGATCCAGGAGCATTTGTTGATTGTTTGTGAACTTCTCAAGGCAAACTTATACGAATTCCATAAGTTCAATAGAGAATCCGGTGGAGAGGTTTATTTCACAATGCCAAGATTGCAGTCGATAACGATCCAGTGTTTGGAGGCACTTGAGTTTTTGCATGGACTAGGGTTGATACATTGTGATTTAAAGCCGGAGAATATATTGGTGAAAAGCTACAGCAGATGTGAAGTGAAGGTGATTGATCTTGGAAGCAGTTGTTT...
729 bp · LXL04_011609|LXL04_011609|OH1004|CDS
ATGATCCAGGAGCATTTGTTGATTGTTTGTGAACTTCTCAAGGCAAACTTATACGAATTCCATAAGTTCAATAGAGAATCCGGTGGAGAGGTTTATTTCACAATGCCAAGATTGCAGTCGATAACGATCCAGTGTTTGGAGGCACTTGAGTTTTTGCATGGACTAGGGTTGATACATTGTGATTTAAAGCCGGAGAATATATTGGTGAAAAGCTACAGCAGATGTGAAGTGAAGGTGATTGATCTTGGAAGCAGTTGTTT...
Protein
Download Protein FASTA242 aa · LXL04_011609|LXL04_011609|OH1004|PROTEIN
MIQEHLLIVCELLKANLYEFHKFNRESGGEVYFTMPRLQSITIQCLEALEFLHGLGLIHCDLKPENILVKSYSRCEVKVIDLGSSCFETDHLCSYVQSRSYRAPEVILGLSYDKKIDIWSLGCILAELCTGNVLFQNDSPATLLARVIGIINPIDQDMLVKGRDTYKYFSKNHMLYDRNQDTNRLEYLIPKKTSFRHRLPIGDEGFIDFVSHLLEINPKKRHSASEALKHPWLSYPYEPISS
Flanking Sequence Download
Sequence orientation and download details
Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.
ID Mapping
| Input ID | LXL04_011609 |
|---|---|
| Source version | OH-1004 / GCA_047496595.1_OSU_TarKok_2.0 |
SNP / Indel variants and carrier samplesCRA009020 · OH-1004
Expand to load variant records for this gene.
Basic Information and Functional Annotation
| Gene ID | LXL04_011609 |
|---|---|
| Location | Chr02:168111326-168112843 (+) |
| Description | Similar to Dyrk3: Dual specificity tyrosine-phosphorylation-regulated kinase 3 |
| Arabidopsis / Rice Reference Genes and Papers |
Download references for this gene ArabidopsisNo hit for this species in the current source table. RiceNo hit for this species in the current source table. |
| Functional annotation source | View annotation sourcesFunctional annotation source: OH1004 · |
| GO annotations (OH1004 source) | GO:0006468 protein phosphorylation Biological Process GO:0010821 regulation of mitochondrion organization Biological Process GO:0018108 peptidyl-tyrosine phosphorylation Biological Process GO:0023052 signaling Biological Process GO:0035063 nuclear speck organization Biological Process GO:0035617 stress granule disassembly Biological Process GO:0051301 cell division Biological Process GO:0051321 meiotic cell cycle Biological Process GO:0051445 regulation of meiotic cell cycle Biological Process GO:0080135 regulation of cellular response to stress Biological Process GO:1902412 regulation of mitotic cytokinesis Biological Process GO:1902751 positive regulation of cell cycle G2/M phase transition Biological Process |
| KEGG gene cross-reference | ddi:DDB_G0293750 mmu:226419 rno:304775 spo:2542326 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene. |
Gene expression
View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.
Data sources and gene correspondence
Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.
Subcellular Localization Top 5
Computational predictions or homology annotations below do not replace localization experiments.
LocPro · Direct prediction · Computational prediction, not experimental localization
Predicted Functional Domains
Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.
PF07714.24PK_Tyr_Ser-Thr3-138 aaPF00069.32Pkinase4-233 aa| Gene ID | Domain ID | Domain Name | Start aa | End aa | E-value | Score |
|---|---|---|---|---|---|---|
| LXL04_011609 | PF07714.24 | PK_Tyr_Ser-Thr | 3 | 138 | 9.3e-13 | 48.8 |
| LXL04_011609 | PF00069.32 | Pkinase | 4 | 233 | 1.5e-40 | 140.0 |
Arabidopsis / Rice Protein Homology
Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.
No result was found for this query.